KEGG   Streptococcus intermedius JTH08: SCIM_0666Help
Entry
SCIM_0666         CDS       T02156                                 

Gene name
rmlC
Definition
dTDP-4-keto-6-deoxy-D-glucose 3,5-epimerase RmlC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SCIM_0666 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCIM_0666 (rmlC)
Enzymes [BR:sie01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SCIM_0666 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
776419..777012
Genome map
AA seq 197 aa AA seqDB search
MSEQFFEKKLAARKIETIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFVEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGETFGNTYQMVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPALGIKWENLDQAEVSEAD
KHHPFLKDVKPLTKDML
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacaattttttgaaaaaaaattagcagcccgcaagattgagactattcccggt
atgttggaatttgatatcccagttcatggagacaatcgtggctggttcaaggaaaacttt
caaaaagaaaaaatgcttccactaggttttccagagagtttttttgtagaaggtaagctc
caaaacaatgtcagcttttcccgcaaaaatgtgctccgtggactccatgcagagccttgg
gataaatacatttctgtcgcagatggtgggaaagttctcggatcttgggttgacttgcgt
gaaggggaaacattcggaaatacctaccaaatggtcattgatgccagcaagggaattttc
gttcctcgcggtgtagcaaatggctttcaagtattgtcagatacggtttcttatagctat
ttggtcaatgattactgggcattggaattgaagcctaagtatgcctttgtcaactatgca
gacccagctctaggcatcaagtgggaaaatcttgaccaggcagaagtttctgaagcggat
aagcatcatccgttcctcaaagatgttaagcctttgacaaaagatatgttataa

DBGET integrated database retrieval system