KEGG   Streptococcus intermedius JTH08: SCIM_0688Help
Entry
SCIM_0688         CDS       T02156                                 

Gene name
fbp
Definition
firmicute fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCIM_0688 (fbp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCIM_0688 (fbp)
   00030 Pentose phosphate pathway
    SCIM_0688 (fbp)
   00051 Fructose and mannose metabolism
    SCIM_0688 (fbp)
  Energy metabolism
   00680 Methane metabolism
    SCIM_0688 (fbp)
Enzymes [BR:sie01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SCIM_0688 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
801663..803585
Genome map
AA seq 640 aa AA seqDB search
MEQYKRILLKEFDSKQKVITELINLEAILNLPKGTELYLSDIHGEFEAFDYILRTCAGNL
NEKINDCFGEELGKAEKDKLTLLIAYPQEVLNDDSLYPLKDKNWYGRIIQNLFTLLAFVA
AKYTRSKVRKALPPQYTYIMEELLYTDRNLPDNNIYFETIQNYLIDLGEANAFILALSKV
IRQLIIDHLHIVGDIFDRGAAADKVMNELMAYHSVDIQWGNHDIIWMGAFFGSKECLLTL
LRIAARYGYLYDIERAYGLNLRPLVLFAEKTYSENAKFKPNLGKRSDSYAPKEILQLEKV
HQALAIIQFKLESQLIQRRPEFDMAQNVTLDKIDYWEESILVGGKKHFLANTCFQTINPQ
KPEELTDEEEEVVATLLDSFQHSLQLKGHISFLMKKGSMYKIYNNHLLFHGCIPLGESGD
FEPLQINEIRYTGKELLDFFEYHIRESSKNPDIQDDFSTDLIWYCWNGKLSPLFGKDKMT
TLERYFIEDKETHIEKENPYFSYRNSAKICKLILEEFGLFSEDSRIVNGHTPVKTLKGES
PIRGEGMLFVIDGGLCEAYQKKTGTAGYSLLNNSYGFQIVTHQPFQNVQKMIEEALDLSS
LKRVIEHVRERTLIKSTTIGQSLIEQQQELSVLLHEFYDY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggagcaatacaaacgaatattattaaaagagtttgattccaagcaaaaagtcatcaca
gagttaatcaatctggaagctattttgaatttacccaaaggaacagaactttaccttagc
gatattcatggtgagtttgaagcttttgattatatcctaagaacctgtgcaggaaatttg
aacgaaaaaatcaacgactgctttggagaagagttaggaaaagcggaaaaagataagctg
accttgctgattgcatatcctcaggaagttttgaatgatgactccctttatccgttgaaa
gataaaaactggtatggaagaatcattcaaaatttatttactttgctcgcgtttgtagca
gccaagtacacgcgctctaaagtaaggaaagctttgccaccacaatatacttacattatg
gaggaattgctttacacggatcgaaatctgccagataacaatatttattttgaaacaatt
cagaactatttgatagacttgggtgaggcaaatgcatttatcttggctctctcaaaggta
attcggcagttgattattgatcatcttcatatagttggtgatatttttgaccgtggagcg
gcagcggataaagtgatgaatgaactcatggcttatcattctgttgatatccaatgggga
aaccacgacatcatctggatgggagctttttttggatctaaagaatgtttgcttactctt
ttgcgaatagctgctagatatgggtatctttacgatattgaacgagcttatggtcttaat
ctaagaccgctcgttctctttgcagaaaagacttattctgaaaatgcaaagtttaaacct
aacttaggcaaaagaagcgatagttatgctccgaaagaaattctccagttggaaaaagtc
caccaagcattagcgatcatccagtttaaattggaaagccagcttattcaaaggcgacca
gagtttgatatggctcaaaatgtgacgcttgataagattgattattgggaagagagtatt
ttagttggaggaaagaagcatttcttagctaatacttgttttcaaacgattaatcctcaa
aagccagaggaattaacggatgaggaagaagaagtggttgctactttgctggattctttc
caacattctcttcaactcaagggtcacatttcttttttgatgaaaaagggttctatgtat
aagatttataataatcatcttctctttcatggttgcattcctttgggagaatccggagac
tttgaacctttgcagatcaatgaaattcgctatactggtaaagaattactcgactttttt
gaataccacatccgagaaagttctaaaaatccagacatccaagatgacttttcaaccgac
cttatctggtattgttggaacggcaaattatctcctttgtttggcaaggacaagatgacc
accttggagcgttactttatcgaggataaggaaacgcatattgaaaaggaaaatccttat
ttttcttatcgaaattctgctaagatttgcaagttgattttagaagaattcggtctcttt
tctgaagattctaggattgtaaatgggcatacacctgtgaaaacgctgaagggagaatca
ccgattcgaggtgaaggaatgctgttcgttattgatggtggtttgtgcgaagcctatcaa
aagaaaacaggaactgctggctattccttgcttaataattcttatggtttccagattgtg
acacatcaaccttttcaaaatgtccaaaaaatgattgaggaagctttagatttatcttcc
ttgaagagagtaattgagcacgttcgcgagcgaaccttgataaaatcaacgacaatcgga
caaagcctcattgaacaacaacaggaattatctgttcttttacatgaattttatgactac
taa

DBGET integrated database retrieval system