KEGG   Streptococcus intermedius JTH08: SCIM_0688Help
Entry
SCIM_0688         CDS       T02156                                 

Gene name
fbp
Definition
firmicute fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:sie01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sie00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sie00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sie00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:sie00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
801663..803585
Genome map
AA seq 640 aa AA seqDB search
MEQYKRILLKEFDSKQKVITELINLEAILNLPKGTELYLSDIHGEFEAFDYILRTCAGNL
NEKINDCFGEELGKAEKDKLTLLIAYPQEVLNDDSLYPLKDKNWYGRIIQNLFTLLAFVA
AKYTRSKVRKALPPQYTYIMEELLYTDRNLPDNNIYFETIQNYLIDLGEANAFILALSKV
IRQLIIDHLHIVGDIFDRGAAADKVMNELMAYHSVDIQWGNHDIIWMGAFFGSKECLLTL
LRIAARYGYLYDIERAYGLNLRPLVLFAEKTYSENAKFKPNLGKRSDSYAPKEILQLEKV
HQALAIIQFKLESQLIQRRPEFDMAQNVTLDKIDYWEESILVGGKKHFLANTCFQTINPQ
KPEELTDEEEEVVATLLDSFQHSLQLKGHISFLMKKGSMYKIYNNHLLFHGCIPLGESGD
FEPLQINEIRYTGKELLDFFEYHIRESSKNPDIQDDFSTDLIWYCWNGKLSPLFGKDKMT
TLERYFIEDKETHIEKENPYFSYRNSAKICKLILEEFGLFSEDSRIVNGHTPVKTLKGES
PIRGEGMLFVIDGGLCEAYQKKTGTAGYSLLNNSYGFQIVTHQPFQNVQKMIEEALDLSS
LKRVIEHVRERTLIKSTTIGQSLIEQQQELSVLLHEFYDY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggagcaatacaaacgaatattattaaaagagtttgattccaagcaaaaagtcatcaca
gagttaatcaatctggaagctattttgaatttacccaaaggaacagaactttaccttagc
gatattcatggtgagtttgaagcttttgattatatcctaagaacctgtgcaggaaatttg
aacgaaaaaatcaacgactgctttggagaagagttaggaaaagcggaaaaagataagctg
accttgctgattgcatatcctcaggaagttttgaatgatgactccctttatccgttgaaa
gataaaaactggtatggaagaatcattcaaaatttatttactttgctcgcgtttgtagca
gccaagtacacgcgctctaaagtaaggaaagctttgccaccacaatatacttacattatg
gaggaattgctttacacggatcgaaatctgccagataacaatatttattttgaaacaatt
cagaactatttgatagacttgggtgaggcaaatgcatttatcttggctctctcaaaggta
attcggcagttgattattgatcatcttcatatagttggtgatatttttgaccgtggagcg
gcagcggataaagtgatgaatgaactcatggcttatcattctgttgatatccaatgggga
aaccacgacatcatctggatgggagctttttttggatctaaagaatgtttgcttactctt
ttgcgaatagctgctagatatgggtatctttacgatattgaacgagcttatggtcttaat
ctaagaccgctcgttctctttgcagaaaagacttattctgaaaatgcaaagtttaaacct
aacttaggcaaaagaagcgatagttatgctccgaaagaaattctccagttggaaaaagtc
caccaagcattagcgatcatccagtttaaattggaaagccagcttattcaaaggcgacca
gagtttgatatggctcaaaatgtgacgcttgataagattgattattgggaagagagtatt
ttagttggaggaaagaagcatttcttagctaatacttgttttcaaacgattaatcctcaa
aagccagaggaattaacggatgaggaagaagaagtggttgctactttgctggattctttc
caacattctcttcaactcaagggtcacatttcttttttgatgaaaaagggttctatgtat
aagatttataataatcatcttctctttcatggttgcattcctttgggagaatccggagac
tttgaacctttgcagatcaatgaaattcgctatactggtaaagaattactcgactttttt
gaataccacatccgagaaagttctaaaaatccagacatccaagatgacttttcaaccgac
cttatctggtattgttggaacggcaaattatctcctttgtttggcaaggacaagatgacc
accttggagcgttactttatcgaggataaggaaacgcatattgaaaaggaaaatccttat
ttttcttatcgaaattctgctaagatttgcaagttgattttagaagaattcggtctcttt
tctgaagattctaggattgtaaatgggcatacacctgtgaaaacgctgaagggagaatca
ccgattcgaggtgaaggaatgctgttcgttattgatggtggtttgtgcgaagcctatcaa
aagaaaacaggaactgctggctattccttgcttaataattcttatggtttccagattgtg
acacatcaaccttttcaaaatgtccaaaaaatgattgaggaagctttagatttatcttcc
ttgaagagagtaattgagcacgttcgcgagcgaaccttgataaaatcaacgacaatcgga
caaagcctcattgaacaacaacaggaattatctgttcttttacatgaattttatgactac
taa

DBGET integrated database retrieval system