KEGG   Streptococcus intermedius JTH08: SCIM_0702Help
Entry
SCIM_0702         CDS       T02156                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCIM_0702
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCIM_0702
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SCIM_0702
Enzymes [BR:sie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SCIM_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818524..818823
Genome map
AA seq 99 aa AA seqDB search
MVFLVELKVSNNDDTLSTQIVFMVQAELLVLLIDVDSFYTANPIHYPDAKGMNLIEKVIS
DSLEMVEAASLEADVFRGKIIKVVAVFYKRTQELEETEP
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggtttttcttgttgagttaaaagttagtaataatgatgatacattgagcacacagatt
gtattcatggtgcaagcagagttgttggttctattgattgatgttgatagtttttataca
gcaaatcctattcattatccagatgcaaagggcatgaatttaatagaaaaggttatatca
gattcgcttgagatggtggaggcggctagccttgaagcggatgttttcagaggcaaaatt
atcaaagtcgttgctgtgttttataagcgtactcaggaactcgaggaaactgaaccatag

DBGET integrated database retrieval system