KEGG   Streptococcus intermedius JTH08: SCIM_1000Help
Entry
SCIM_1000         CDS       T02156                                 

Definition
Mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCIM_1000
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCIM_1000
Enzymes [BR:sie01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SCIM_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1141737..1143080
Genome map
AA seq 447 aa AA seqDB search
MKINTALGLLAGKSSHFVLSKMGRGSTLPGKVALTFDKNILQNLAKNYEVVVITGTNGKT
LTTALTVGILKEVFGEVVTNPSGANMIAGITTTFLTAKKGKSGKNIAVLEIDEASLSRIC
DYIKPSLFVFTNIFRDQMDRYGEIYTTYQMILDAAAKVPEATVLMNGDSPLFNSVRLKNP
VRYYGFDTKKGQAELAHYNTEGILCPKCQHILKYKLNTYANLGDYICEYCHFKRPELNYK
LTQLTSLHHNSSEFVIDDQDYHINIGGLYNIYNALAAVSVAQFFEVDSATIKAGFDKSRA
VFGRQETFKIGDKECTLVLIKNPVGATQALEMIKLAPYSFSLSVLLNANYADGIDTSWIW
DADFEKILDMDISHIIAGGVRHSEIARRLRVTGYDAKQINEVADLSQVFEEIKHQKTRHA
YILATYTAMLEFRELLASNQVVRKEMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaatacagcattgggccttttggcaggcaagtcctcccactttgttctcagc
aaaatggggcgtggttcgaccctgccagggaaagttgccctaacatttgacaaaaacatt
ttacaaaacctagcgaagaactatgaggtcgtggttattaccggaaccaatggtaaaact
ctaactacagctctgacggtaggcattctcaaggaagttttcggagaagtggtgaccaat
cccagtggtgccaatatgattgcggggattaccacaactttcctgaccgctaagaaaggc
aaatctggcaagaatattgctgtactagaaattgacgaagcgagtctttctcgtatttgt
gactatatcaagccaagcctttttgtctttaccaatattttccgtgaccaaatggatcgt
tacggagagatttacacgacctaccaaatgattctcgatgctgcagcgaaagtacctgaa
gcgactgtactgatgaacggtgacagcccgctctttaactcggtcagactgaagaatccc
gtccgctactatggatttgacaccaaaaaagggcaagctgagttagcgcattataatact
gagggcatcctctgtcccaagtgtcagcatattctaaaatacaagctcaatacttatgct
aatttaggtgattatatttgtgaatattgtcattttaaacgccctgaattaaactacaaa
ctgacccaattaactagccttcaccacaatagttcagaattcgtcattgatgatcaagac
tatcacatcaatattggaggcctttataacatctacaacgctttagcagccgtttctgtt
gctcagttctttgaagtcgactcagctaccatcaaggctggttttgacaaaagtagagcc
gttttcggacgtcaggaaacgttcaagattggcgacaaagaatgcacgctagttctgatt
aaaaatccagttggagctacgcaagctctagaaatgatcaagcttgctccttattcattc
agtttgtcagttctcctcaacgccaactacgcagatggcattgataccagctggatttgg
gacgctgattttgagaaaattttagacatggatatctcgcatatcattgctggtggtgtt
cgtcattctgaaattgctcgtcgcttgcgagtcactggttatgatgccaagcaaatcaat
gaagtagctgatttgagtcaagtctttgaagaaattaaacatcagaaaaccagacatgcc
tatatcttagcaacctacaccgccatgttagaatttcgtgaactacttgcttctaatcag
gttgtcagaaaggagatgaactaa

DBGET integrated database retrieval system