KEGG   Streptococcus intermedius JTH08: SCIM_1064Help
Entry
SCIM_1064         CDS       T02156                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCIM_1064 (pfk)
   01230 Biosynthesis of amino acids
    SCIM_1064 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCIM_1064 (pfk)
   00030 Pentose phosphate pathway
    SCIM_1064 (pfk)
   00051 Fructose and mannose metabolism
    SCIM_1064 (pfk)
   00052 Galactose metabolism
    SCIM_1064 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SCIM_1064 (pfk)
Enzymes [BR:sie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCIM_1064 (pfk)
Protein phosphatases and associated proteins [BR:sie01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCIM_1064 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1209993..1211003)
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGIYDGYAGMVAGEIYPLDAASVGDI
ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRNAGDIALWA
GIATGADEIIVPEEDFKIEDIVASIKRGYEEGKKHNIIVLAEGVMSADEFGKKLKEAGDV
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVSLLKKGIGGVAVGIRNEQMVENPILGT
AEEGALFSLTEDGKIIVNNPHKADLDLAKLNRSISM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggtggtgatgcccctggtatgaacgctgctatc
cgtgcagttgttcgcaaagcaatttcagaaggaatggaagtttatggcatctatgacggc
tatgctggtatggttgctggtgaaatttatccacttgatgctgcatcggttggggatatt
atttcacgtggtggtactttccttcactcggctcgttatccagagtttgcccaattagaa
ggacaattaaagggaattgagcaactaaaaaaacatggcattgaaggagttgtggttatc
ggtggtgacggttcttatcatggtgctatgcgtttgacagaacatggcttccctgctgtt
ggattaccaggtacgattgataatgacattgttggtacagatttcacaattggttttgat
actgctgtaacgactgcaatggatgcaattgacaagattcgtgatacatcatctagtcat
cgtcgtacttttgttgttgaagtaatgggacgtaatgctggagatattgctctctgggct
ggtattgctacaggtgctgatgaaatcatcgttcctgaagaagacttcaaaatcgaagat
attgtagctagtattaaacgtggctatgaagaaggaaagaaacacaacattatcgttctt
gcagaaggtgtcatgtctgctgatgaatttggtaaaaagttgaaagaagctggtgatgta
agtgatcttcgtgtaacggaacttggacatattcaacgtggtggttcaccaactgcccgt
gaccgtgttcttgcttcacgtatgggagcacatgctgttagtttgcttaaaaaagggatt
ggcggtgttgcagttggtattcgcaacgaacaaatggttgaaaatccaattttaggcaca
gcagaagaaggtgctttgtttagtttaacagaagacggtaagattattgttaataatcca
cataaagctgatcttgatcttgctaaattaaaccgtagcatttcaatgtaa

DBGET integrated database retrieval system