KEGG   Streptococcus intermedius JTH08: SCIM_1255Help
Entry
SCIM_1255         CDS       T02156                                 

Definition
M20/M25/M40 family peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCIM_1255
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCIM_1255
Enzymes [BR:sie01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SCIM_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1434703..1436076)
Genome map
AA seq 457 aa AA seqDB search
MTFSSEEEQIKRFEEDMVAQDYIAVLRALISKKSIFAQQVGLQEVAAYLKEIFIKAGAEV
ELDESYTAPFVIAKFKSQNPTAKTIIFYNHYDTVPADSDQIWTDDPFTLSIRDGGMYGRG
VDDDKGHIIARLTAVQKYLQTHDDLPVTVIFIMEGAEESASVDLEKYIEKHKSLLHGADL
LVWEQGIKNSLGQLEISGGNKGIVTFDIKAKSAEVDIHSSFGGVIDSASWYLINALTSLR
NKDGRIKVEGLYEQVITPNQRELALVERYAQRSPEEVEAIYGLKLPLLQAEKKDFLNRIF
FEPSFNIEGITSGYQGQGVKTILPAEASAKVEVRLVPGLEPHRVLELIRKQLDKNGFDKV
ELVYTLGEMSYRSDMSAPPILKVIELAKKFYKKGVSVLPTTAGTGPMHTVFEALEVPIVA
FGLGNANSRDHGGDENVRIADYYTHIELVEELIVSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacattttcaagtgaagaagaacaaattaaaagatttgaagaggatatggtggcacaa
gactatattgccgttttgcgggcattgatttctaaaaaatcaatctttgcccaacaggtt
ggtctacaagaagttgctgcttatctaaaagaaatctttatcaaagccggtgcagaggtg
gaattagatgaaagttatacagcgccatttgtgatagcaaaatttaaaagtcagaatcca
acagctaagacaattattttttacaaccactatgatacagttccggcagatagtgatcaa
atttggacagatgatccgttcactctatctattcgggatggtggcatgtatggtcgtgga
gtcgatgatgacaaagggcatattattgcacgtttgacggctgttcaaaaatacctacaa
actcatgatgacttgcctgttactgtcatttttatcatggaaggtgcggaggaatcagct
tcggttgatttggagaaatatatagagaaacacaaatctcttctacacggagcagacctg
ttggtttgggagcaaggcattaaaaattctttaggtcaacttgaaatttctggtggaaat
aagggaattgtcacgtttgatatcaaggctaaaagtgcagaagtggacattcactccagt
tttggtggcgtgattgattcagcttcttggtacttgattaatgcccttactagcttgaga
aataaggatggacgcattaaagtagaagggctttatgaacaagtaataacacccaatcaa
cgagaattggctttggtggagagatacgctcagcgcagtccagaagaagtagaagccatt
tacggtttgaaattacctttattacaagcggagaaaaaagattttttaaatcgaatcttc
tttgaaccctcttttaatattgaaggaattacttctggttaccaaggacaaggagtcaag
acaatccttcctgcagaagcctcagcaaaagtagaagttcgtttagttccaggactagaa
cctcatagagtattagaattaatccgaaaacaactcgataaaaatggttttgataaggta
gaattagtctatactttgggcgaaatgagttatcgtagtgatatgagtgcgccaccgatt
ttaaaggttattgaactggctaagaaattctataaaaaaggagtttctgtcttgccgacc
acagccggtacaggtccgatgcatacagtatttgaagctcttgaagtaccgatcgtcgct
tttggacttggtaatgcaaatagtcgagaccatggtggtgatgagaatgtacgcattgca
gattattacacccatattgaattagtagaggagctgattgtaagttatgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system