KEGG   Streptococcus intermedius JTH08: SCIM_1308Help
Entry
SCIM_1308         CDS       T02156                                 

Definition
family 1 glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCIM_1308
Enzymes [BR:sie01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SCIM_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1488880..1490277
Genome map
AA seq 465 aa AA seqDB search
MTFLTFPKGFFWGTASSGPQTEGRFDGDGKGENIWDYWYNKEPEKFFNHIGPDKASYNYQ
YYKEDVQLMKATGHNSFRTSIQWSRLIPEGVGAVNPQAVDFYNSFIDELITNGIEPFINL
YHFDMPMALQAKGGWLNRETVDAYVNFARTCFDLFGDRVKYWFTHNEPIVPVEGGYLYNF
HYPNEVNMKHAVQVAFHEMLASSLAVRAYHEKQDGKIGIILNLTPSYPRDENNPEDVKAA
QIADAFFNRSFLDPAIKGEYPADLIALIKELNMVPEHTNEDLKTIKENTIDLLGVNYYQP
RRVQAKEKPIDKNPQNPMPDDFFDYYDMPGKKMNPYRGWEIYEKGIYDIMMNVRDNYGNL
PCYISENGMGVEGEERYINANGQIEDEYRIEFVKNHLRYLHQAIHEGANCLGYHMWTCMD
NWSWNNAYKNRYGLIAVDLDKQGKRTIKKSGYFFKELSDKNGFED
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttaacatttccaaaaggctttttctggggaactgcttccagtgggccgcaa
acagaaggtcgatttgacggtgatggaaaaggagagaatatctgggactattggtacaac
aaagaacctgaaaaatttttcaaccatattggacctgataaagcttcctataattatcag
tattacaaagaagatgtgcaactaatgaaagcaactggacacaattctttccgcacttct
atccaatggagtcggctaatcccagaaggtgttggtgctgttaatccacaagccgtagat
ttttacaattcattcattgatgaactgattacaaatggaattgaaccatttattaactta
taccattttgacatgccaatggcactacaagcaaaaggcggttggcttaatcgggaaacg
gttgatgcttatgtaaactttgcaagaacctgctttgacctatttggtgaccgcgtcaaa
tattggttcactcacaatgaacccattgttcccgtcgaaggtggctacctctacaatttc
cattatccaaatgaagtcaacatgaaacacgctgtacaggtggcttttcacgaaatgctc
gccagcagcttagctgtcagagcctatcacgaaaagcaagatggtaaaattgggattatc
ctcaacttaaccccaagctatccgcgtgatgagaataatcctgaagacgtcaaagctgct
caaattgcagatgctttctttaatcgctctttcttagatcctgccatcaaaggcgaatac
cctgctgatttgattgctcttattaaggaactaaatatggtgccagaacacacaaatgag
gatttaaagaccattaaagaaaataccattgacttgcttggtgtcaattattaccagcca
cgtcgagttcaagccaaagaaaaacctattgataaaaatccgcagaatcctatgccagat
gatttctttgactactatgatatgccaggaaaaaaaatgaacccttatcgcggttgggaa
atctatgaaaaaggaatctacgacattatgatgaatgttcgtgataactatggaaatctt
ccttgctatatctcagaaaatggtatgggggttgaaggtgaagaacgttacatcaacgca
aatggtcaaattgaagatgagtatcgtatcgaatttgtcaaaaatcatcttcgctacctt
catcaagctatccacgaaggagccaattgcttaggataccatatgtggacttgtatggat
aactggtcttggaataacgcctataaaaatcgctatggcctcattgctgttgacctagac
aaacaaggcaagcgaaccattaaaaaatcaggttatttctttaaagaactgtctgacaaa
aatggttttgaagactaa

DBGET integrated database retrieval system