KEGG   Streptococcus intermedius JTH08: SCIM_1363Help
Entry
SCIM_1363         CDS       T02156                                 

Gene name
basA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sie00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sie00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1550099..1550575
Genome map
AA seq 158 aa AA seqDB search
MTKIYDFSIFDQNNRSISLEIYKGNVLLIVNTATGCGLTPQYKGLQHLYTRYQNQGFEIL
DFPCNQFMGQAPGTAEEINRFCSLHYQTTFPRFAKVKVNGKEADPLYIWLKEQQAGPLGK
RIEWNFTKFLINREGQVVKRFSSKAEPKEIEESLQKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatatatgatttttccattttcgatcagaataatcgatctatctccctagaa
atttataaagggaatgttctgcttattgtcaatactgcaacaggttgtggcctgaccccc
caatataagggactacaacacctctacacccgctatcaaaaccagggctttgaaatcctc
gactttccttgtaatcaatttatggggcaggcaccaggtacagcagaagaaatcaatcgt
ttttgcagcctccactaccaaactacttttccacgttttgctaaagttaaagtcaatggt
aaggaagcagatcctctctatatctggctaaaagaacaacaagctggccccctcggaaaa
agaatcgaatggaattttactaaattcttaataaaccgagaagggcaagttgtgaaacga
ttttcatctaaagcagaacctaaagagattgaggaaagtttacaaaagctattataa

DBGET integrated database retrieval system