KEGG   Streptococcus intermedius JTH08: SCIM_1516Help
Entry
SCIM_1516         CDS       T02156                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sie00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1731649..1733106)
Genome map
AA seq 485 aa AA seqDB search
MANQIRVRYAPSPTGLLHIGNARTALFNYLYARHYGGTFIIRIEDTDRKRHVEDGERSQL
ENLRWLGIDWDESPETHEKYRQSERLDIYQSYINELLEKGLAYKSYVTEEELAAERERQE
AAGETPRYINEYLGMSEDEKAAYIAEREAAGIVPTVRLVVNESGIYKWNDLVKGEIEFEG
GNIGGDWVIQKKDGYPTYNFAVVVDDHLMKISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEDEIFSR
EELINLFDEHRLSKSPAAFDQKKMDWMSNEYIKNADFETIFAMAKPFLEEAGRLTDKAEK
LVELYKPQMKSVDEIVSLTDLFFEDFPELTDAEKEFMAGETVPTVLQAFKEKLEAMSDED
FKSENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIYLLGREKSIEHIENM
LKNIQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaatcaaattcgtgtgcgttacgcaccaagtccaacgggacttttacacattgga
aatgcgcggactgcgctctttaattatctttacgctcgtcactacggcggaacttttatc
attcggattgaagatactgaccgtaaacgtcatgtggaagacggggaacgttcgcagttg
gaaaatctgcgttggttaggaattgattgggatgagagcccagaaacgcatgaaaaatat
cgccagtctgaacgcttggacatttaccaaagctatatcaatgagttacttgaaaaaggc
ttggcttacaaatcatatgtgacggaggaagagctggcagcagagcgtgagcgtcaggaa
gctgctggagaaacacctcgttacatcaatgaatatctgggaatgtctgaagatgaaaaa
gcagcttatatcgcagagcgtgaagcagcaggcattgttccaacagtccgtcttgtggtc
aatgaatctggtatttacaagtggaacgatcttgtcaaaggtgagattgaatttgaaggt
ggcaacatcggtggtgactgggttatccagaaaaaagacggctatccaacttataatttt
gcggttgtagtagatgaccatctgatgaaaatttcccatgttattcgtggggatgaccac
atcgcaaacacaccaaaacaattgatggtttacgaagcacttggttgggaagcaccagaa
ttcggccacatgacattgattatcaactctgaaacgggaaaaaaattgtcaaaacgtgac
actaacacacttcaatttatcgaagactaccgtaaaaaaggttacatgccagaagcagtc
tttaactttatcgcacttcttggttggaacccaggtggtgaagatgaaatcttctcccgt
gaagaattgattaacctctttgatgaacaccgtttgagcaagtcgccagcagcttttgac
caaaagaaaatggactggatgagcaacgaatacatcaagaatgcagatttcgagacaatc
tttgcaatggcgaaaccattcttggaagaagctggtcgtttgactgataaagcagaaaaa
ttagttgaactttacaaaccacaaatgaaatctgttgacgaaatcgtttcattgactgat
ttgttctttgaagatttcccagaattgacagacgctgaaaaagaattcatggcaggtgaa
acagtaccaactgttttacaagcatttaaagaaaagttggaagcgatgagcgatgaagat
ttcaaatcagaaaatatcttcccgcaaatcaaagcagttcaaaaagaaacggggattaaa
ggcaaaaatctcttcatgccaattcgtatcgctgtttcaggtgaaatgcacggtccagaa
cttccagatactatctatctgcttggacgtgagaaatcaattgagcacatcgaaaatatg
ttaaagaacattcaataa

DBGET integrated database retrieval system