KEGG   Streptococcus intermedius JTH08: SCIM_1522Help
Entry
SCIM_1522         CDS       T02156                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCIM_1522 (galU)
   00052 Galactose metabolism
    SCIM_1522 (galU)
   00500 Starch and sucrose metabolism
    SCIM_1522 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SCIM_1522 (galU)
Enzymes [BR:sie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCIM_1522 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1738845..1739741
Genome map
AA seq 298 aa AA seqDB search
MTQVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIKDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKSDLLKLVDETTGIGLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNDKAVPLTKQLMNDYKETHASTIAVMKVPHDDVSSYGVIDPQG
EGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFSILETQAPGAGNEIQLTDAIDT
LNKTQRVFAREFTGDRYDVGDKFGFMKTSIDYALKHPQVKDDMKQYIIDLGKKLDKKN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtaagaaaagctgttattcctgctgctggacttggaactcgtttcttgcca
gccacaaaagcgctcgccaaagaaatgctacctattgttgacaaaccaactattcaattt
attgtcgaagaagcattaaaatctggtatcaaagacatcttggttgtaaccggaaaatct
aaacgatctattgaagaccactttgattcaaactttgaattggagtataacctcaaagaa
aaagggaaatctgaccttttaaaactcgtagatgaaacaactggtatcggccttcatttc
attcgccaaagccatccacgcggtcttggagatgccgttttacaagccaaagctttcgtt
gggaatgaaccctttgtcgttatgttaggtgatgatctgatggacattacaaacgacaaa
gcagttccgctaaccaaacagttaatgaatgattacaaagaaacacatgcatcaaccatt
gctgtcatgaaagtaccacacgatgacgtttcgtcttatggtgttattgacccgcaaggt
gaaggagtaaatggactctacagcgtggagacctttgttgaaaaaccaaaaccagaagac
gcaccaagtgaccttgcgattattggtcgctaccttttgacaccagaaatcttctccatt
ttggaaacacaagctccaggtgctggaaatgaaatccaactgacagatgccattgatact
ctcaataaaacacaaagagtatttgcccgtgaattcacaggtgatcgttatgacgttggt
gacaaatttggctttatgaaaacatctattgattacgccctcaaacatccccaagtaaaa
gatgacatgaaacaatatatcatcgatttgggtaaaaaattagataagaaaaactaa

DBGET integrated database retrieval system