KEGG   Streptococcus intermedius JTH08: SCIM_1699Help
Entry
SCIM_1699         CDS       T02156                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sie  Streptococcus intermedius JTH08
Pathway
sie00010  Glycolysis / Gluconeogenesis
sie00051  Fructose and mannose metabolism
sie00562  Inositol phosphate metabolism
sie01100  Metabolic pathways
sie01110  Biosynthesis of secondary metabolites
sie01120  Microbial metabolism in diverse environments
sie01130  Biosynthesis of antibiotics
sie01200  Carbon metabolism
sie01230  Biosynthesis of amino acids
Module
sie_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sie_M00002  Glycolysis, core module involving three-carbon compounds
sie_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCIM_1699
   00051 Fructose and mannose metabolism
    SCIM_1699
   00562 Inositol phosphate metabolism
    SCIM_1699
Enzymes [BR:sie01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCIM_1699
Exosome [BR:sie04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCIM_1699
  Exosomal proteins of bladder cancer cells
   SCIM_1699
  Exosomal proteins of melanoma cells
   SCIM_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAM24351
Position
complement(1922184..1922873)
Genome map
AA seq 229 aa AA seqDB search
MLVVFNLKNQMSIEQQLELLEKFNKPISKQHQLIIAPIIPDYDKYHFDIAVQNLSMKGKN
VGDLSPQHLKHYNINYAFVGHLERQKYLNETVRIIRSKIDNALQTEITPIICVGNNENPI
FECATYLDGLNLQDNHIIIAYEMLSATLKGEKDYSFTKVEENFQDLKNYLDNLSVKFRFT
YQLIFGGGVNCEDVEQILTIGFDGILIGDRIGSLVETYQYLVKDSFALT
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgttagttgtgtttaatttaaaaaatcagatgtctattgagcaacagttagaattatta
gagaagttcaataaaccaataagcaagcagcatcaattgattatagctcctattatacca
gattatgataaatatcattttgatattgcagttcaaaatttgtcaatgaagggaaagaat
gtaggagatttatcacctcaacatttaaaacattacaacataaattatgcttttgtaggt
catctagaaaggcaaaaatatttaaatgagacagtaagaattattcgttcaaagattgac
aatgctttacagacagagattactcctattatttgtgtaggaaataatgaaaatcctatt
tttgaatgtgcaacatatttagacggtttaaaccttcaagataatcatattatcatagct
tatgaaatgttaagtgcaacattaaaaggagaaaaggattattcatttaccaaagtcgaa
gaaaattttcaagatttaaaaaactatttggataatttaagtgtaaagtttagatttaca
tatcagttgatttttggtggcggtgtaaattgtgaagatgttgaacagattttaactatt
ggatttgatggtattcttattggagatagaattggtagtttagttgaaacatatcaatat
ttagtaaaagatagttttgcattgacataa

DBGET integrated database retrieval system