KEGG   Streptococcus infantarius: Sinf_0043Help
Entry
Sinf_0043         CDS       T01765                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sif  Streptococcus infantarius
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinf_0043 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinf_0043 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sinf_0043 (thrC)
Enzymes [BR:sif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sinf_0043 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53179..54663
Genome map
AA seq 494 aa AA seqDB search
MTLIYQSTRDENNKVTASQAILQGLATDGGLFTPTSLPEVALDFDALKDASYQEVAKLVL
SAFLDDFTEEELDYCINSAYDEKFDTPAIAPVVKLADQYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKIQELQMT
TQTGNNTHVVAITGNFDDAQTDVKRMFNDVALREKLLAHKTQFSSANSMNVGRLVPQVVY
YVYAYAQLVKAGHIKAGEKVNFTVPTGNFGNILAAYYASQIGVPVGKLICASNENKVLTD
FFTTGTYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNDAAKTKDLMEKLVSEGEYTLS
GANQAILDMFEAGFATEAETSAEIKRVYDACDYVEDPHTAVASAVYQKYVERTGDHTPTV
IASTASPYKFPRVAVEAVSGQAPADDFAAVKELEKLSGVAIPKAINGLETAEVRHKTVVT
TSDMQKAVEDYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaatttaccaatcaactcgcgacgaaaataacaaagtgactgctagccaagct
attttacaaggattggcaactgacggcggactcttcaccccaacgtcacttccagaagtg
gctttggactttgatgctttaaaagatgcttcataccaagaagtggctaaactggttcta
tcagcgtttttggatgattttacagaagaagaattagattactgtatcaattcagcttat
gatgaaaaatttgacacacctgccattgctccagtcgttaaactagcagaccaatataac
cttgagcttttccatggttcaacaatcgcttttaaagatatggctttgtcaatcttgcca
taccttttgacaacatcagctaaaaaacaaggtgttgataataaaattgtgattttaaca
gcaacatcaggagatactggtaaagctgctatggctggttttgcagatgttccaggaact
gaaattattgtcttttatccaaaagatggcgtcagcaaaattcaagaacttcaaatgaca
acgcaaactggtaacaatacgcatgttgtagcgattactggtaactttgatgatgctcaa
acagatgttaaacgtatgtttaatgacgtggctttacgtgaaaaattgcttgcgcacaag
acacaattctcatcagctaactcaatgaacgttggtcgcttggtgccacaagttgtttac
tatgtctacgcttatgcacaattggttaaagcaggtcatattaaagcaggtgaaaaagtt
aactttacagtaccaacaggtaactttggtaatatcttagcagcatactacgctagtcaa
attggtgttccagttggtaaattaatctgtgcttcaaatgaaaataaagttttaactgat
ttcttcacaacaggtacatatgataaaaaacgtgagtttaaggtgacaacaagtccatca
atggatatcttggtatcatctaacttggaacgtttgattttccaccttttgggtaacgat
gctgctaaaacaaaagacttgatggaaaaacttgtatctgaaggagagtacactctttca
ggtgctaatcaagctattcttgatatgtttgaggctggttttgcaacggaagctgaaaca
tcagctgaaatcaaacgtgtttatgatgcttgtgactatgttgaagacccacacacagct
gttgcgtcagctgtttatcaaaaatatgttgaacgaactggtgatcatacgccaactgtt
attgcgtctacagcaagtccttataaattcccacgtgttgccgtagaagctgttagtgga
caagcaccagcagatgactttgctgcggtaaaagaacttgaaaaattgtcaggtgtcgct
attccaaaagctatcaacggacttgagacagctgaggttcgccacaaaacagttgttact
acaagtgatatgcaaaaagctgttgaagattatttaggactttaa

DBGET integrated database retrieval system