KEGG   Streptococcus infantarius: Sinf_0075Help
Entry
Sinf_0075         CDS       T01765                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sif  Streptococcus infantarius
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sif00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77994..78842
Genome map
AA seq 282 aa AA seqDB search
MVIIEKAPAKINLGLDIVGKRPDGYHDLSMVMVSVDLNDYITVSEISGSDIIVESNNHKI
PLNAKNDVFKAAQLIKNRYGIKSGVKIELEKTIPICAGLGGGSTDAAATIRALNKLWQLE
LSKEEMIEIGFQVGSDVPYCLGAGCACISGKGEIVECLNTSLSAWVVLVKPDFGVSTRTV
FPEIDCETISRVDIDSLKEAVLANDYEQIIAHMGNSLEDITIKRKPFIQKIKDRMMKCGA
DAALMTGSGPTVFGLCRSEKKADRLVNSMRGFCKEVYKVRIL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggttattattgaaaaggcacctgctaagattaatttaggcttggatattgttgggaaa
aggcctgatggttatcatgatttatcaatggttatggttagtgttgatttgaatgactat
atcacggtatctgagatttctggctcagatattattgttgagtctaataatcacaagata
cctttaaatgctaaaaatgatgtttttaaggcagctcagctcattaagaatagatatggc
atcaagtctggtgttaagattgaactggagaaaacaatccctatctgtgctggtttgggt
ggcgggtcaactgatgctgctgccactatcagggctttaaataagttatggcaacttgaa
ttatctaaagaagaaatgattgagattggctttcaagtggggagtgatgtcccttattgt
ttgggagctggttgtgcctgcatttctggtaagggtgagattgtggagtgtttaaatact
tctttatctgcttgggttgttttggttaaacctgattttggggtttcaacgcgcacggtt
tttcctgagattgattgtgagacgatttctcgtgttgatattgattctttaaaggaagct
gttttagctaatgattacgaacagattattgctcatatgggaaattctttagaggatatt
accattaagcgcaagccatttatccaaaagatcaaggatcggatgatgaagtgtggggcc
gatgctgctttgatgacaggaagtggtccaacggtttttggtttgtgtcgttcagagaaa
aaggcagaccgtttggttaatagtatgcgaggcttctgtaaggaagtttacaaagttcga
atattgtga

DBGET integrated database retrieval system