KEGG   Streptococcus infantarius: Sinf_0199Help
Entry
Sinf_0199         CDS       T01765                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sif  Streptococcus infantarius
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sif00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sif00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sif00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192989..195151
Genome map
AA seq 720 aa AA seqDB search
MGIKIEGNLFYVNSKNMSLIIENHEGDLLLRHIGGKITAYHGSNALFEKDHAFSGNPTPD
DRTYSFDTQRQILGVHGFGDFRQPSISISHDTNDLTQFKLKDYHVLSGAVEAAGLPNPHS
TENAETLALVLEDKLAGLELTLYYTAYAERSTISSFAKISNLSDKAVVINRVLSTMLDVP
ASDYDVVTLQGAYAREKTVRRHKLEQGIFTVASNRGASGHAHTPAMVLCDHTATEDAGQA
LALQLLYSGNFQAFVQKNQLNEVRLGIGINDDNFAWELSADDSFDTPVAIMTYSAKGLTH
LTHESQLFVQEHIMPKQFAHVERPILINNWEATYFDFKKEKLLDLADEASKLGIELFVLD
DGWFGNRFDDNRALGDWVVNEEKLGGPLNDLINQVHAKGLKFGLWFEPEMISVDSDLYRA
HPDWGIQSKGRGHTYSRNQLVLNLANPDVVAYIKSAIDKILTENAIDYVKWDYNRNITNI
GNGDSVLATQMQSHAYMLGLYDLVSYLTEKHSNILFESCSGGGGRNDLGMMRYFPQVWAS
DNTDAISRLPIQYGSSYLYPTISMGAHVSASPNHQMGRTTPLETRGNVAMMGNLGYELDL
TSLPQAEKDVIAAQVAHYKDIRPVVQFGKQYRLINPEAGSNEAAVEFVYEDKVVVTYVRT
LSTIERIETTLKLKGLEEEATYQLQGIDQVFSGAELMYAGLTTILPQGDYLSKQYYFVKQ
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggggatcaaaattgaaggaaatctattttacgtaaatagtaaaaatatgtcactgatt
attgaaaatcacgagggagatttgttgcttcgtcatattggaggaaaaatcacagcttac
catggctctaatgctctttttgaaaaagaccatgccttttcaggtaatccaactcctgat
gatagaacttacagtttcgatacgcaacgtcagattttgggggtacatggctttggtgat
tttcgccagccatccattagtatttcacacgacactaatgacttaacgcaatttaaatta
aaagattatcacgtcttatcaggagctgttgaggcagcagggctaccaaatccacacagt
acagaaaatgctgaaacacttgctttagtcttagaagataagttggctggtttggagttg
acgctttattacacagcttatgctgagcgttcaacaatttctagctttgctaagattagc
aatttatcagataaagcagttgttatcaaccgcgttctgtcaactatgcttgatgttcca
gcttctgattatgatgtggtgactttgcaaggagcttatgcgcgtgaaaagacagttcgt
cgccataagcttgaacaaggtattttcactgtcgcttcaaatcgtggtgcttcaggtcat
gcacacacaccagctatggtgttatgtgaccacacagctacggaagatgctggtcaagct
ttggcacttcaattgctttatagtggtaatttccaagcttttgttcaaaaaaatcaattg
aacgaagttcgtttgggtatcggaattaacgatgataactttgcttgggaattgtcagcg
gacgatagttttgacacaccagtagccatcatgacttattcagccaaaggtttgacacat
ttgactcatgaaagtcaattatttgtccaagaacatatcatgccaaaacaatttgctcat
gttgaacgtccgattctcatcaacaactgggaagcgacttattttgatttcaaaaaagag
aaattgcttgacttagctgatgaagctagcaagcttggtatcgaactttttgttcttgat
gatggttggtttggcaatcgcttcgatgataaccgtgcacttggtgattgggtggttaac
gaagaaaaacttggtggtccattaaatgacttgattaatcaagttcacgccaaaggattg
aaatttggtttgtggtttgaaccagagatgatttctgtggacagtgacctttaccgtgca
catcctgactggggcattcaatcgaaaggacgcggtcatacttattctcgcaaccaattg
gtgctcaaccttgctaatccagacgtagtagcctatatcaaatcagctatcgataagatt
ttgacagaaaatgctattgattatgttaaatgggattataaccgcaatatcacaaacatc
ggaaatggtgattcagtccttgcgacacaaatgcagtcacatgcttatatgctgggcttg
tatgatttggtgtcttatttgacagaaaaacatagtaacattctctttgaatcttgctca
ggtggcggtggtcgaaatgaccttggtatgatgcgctatttcccacaagtttgggcgagt
gataatactgatgctatttcacgtttaccaattcaatacggttcaagctatctttacccg
acaatttctatgggagctcacgtgtcagctagtcctaatcatcaaatggggcgcacaaca
ccgcttgaaactcgtggtaatgtcgcgatgatgggaaatcttggctacgaacttgatttg
acaagtttaccacaagctgaaaaagatgtgattgctgctcaggttgcacactacaaagac
attcgaccagttgttcaatttggtaaacaatatcgcctcatcaatccagaagcaggttca
aatgaagcagccgtagaatttgtttatgaagataaggttgtcgtgacctacgtgcgcaca
ctgtcaacgattgaaagaattgaaacaacacttaagttgaaaggattggaagaagaggca
acttaccaactacaaggaatagatcaagtcttctcaggggcagagctcatgtatgcgggc
ctcacaacgattctcccacaaggtgattacctcagtaaacaatactatttcgtgaaacaa
taa

DBGET integrated database retrieval system