KEGG   Streptococcus infantarius: Sinf_0222Help
Entry
Sinf_0222         CDS       T01765                                 

Definition
(GenBank) alcohol-acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sif  Streptococcus infantarius
Pathway
sif00010  Glycolysis / Gluconeogenesis
sif00350  Tyrosine metabolism
sif00620  Pyruvate metabolism
sif00625  Chloroalkane and chloroalkene degradation
sif00626  Naphthalene degradation
sif00650  Butanoate metabolism
sif01100  Metabolic pathways
sif01110  Biosynthesis of secondary metabolites
sif01120  Microbial metabolism in diverse environments
sif01130  Biosynthesis of antibiotics
sif01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinf_0222
   00620 Pyruvate metabolism
    Sinf_0222
   00650 Butanoate metabolism
    Sinf_0222
  Lipid metabolism
   00071 Fatty acid degradation
    Sinf_0222
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sinf_0222
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sinf_0222
   00626 Naphthalene degradation
    Sinf_0222
Enzymes [BR:sif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sinf_0222
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sinf_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 DUF1835
Motif
Other DBs
NCBI-ProteinID: AEZ61589
UniProt: H6PD85
Position
222480..225161
Genome map
AA seq 893 aa AA seqDB search
MAKATNADVKNDELSAEELAQQYTGALVEKALEAERVYATYSQEQVDNIVAAMALAGSEA
SLELAKEAHAETGRGVVEDKDIKNHFATEYVYERIKNEKTVGIIGEDKVSGSIQIAAPLG
VLAGIVPTTNPTSTTMFKILVALKTRNAIVFAFHPQAQNCSAHAAQILYDAAVKAGAPEN
IVQWIETPSLANTSALIQNPKIASILATGGPGMVNAALKSGNPSMGVGAGNGAIYVDATA
HVDRAVEDLLLSKRFDNGMICATENSAVVEAPIYDEWLQKMQDKGAYLVPKKDYKKLEDF
VFNDRHGVNGPVAGMPARWICEQAGVKLPEGKDVLLFELDKKNIGEKLSSEKLSPLLSVY
KAKDRAEGVEIVEALLDYQGAGHNAGIQIGSQADPFVAEYGDAVKASRVLVNQPDSVGGI
GDVYTDALKASLTLGTGSWGKNSLSHNLSTGDLLNVKTVAKRRNRPQWIRLPEKTYYEKN
AISYLQDEYEPMQRALIVADPGMVQFGFVDTVLAQLALRDEKVATSIYGTIKPDPTLGQT
IEIAKQMRDFKPDTVIAVGGGSALDAAKIARYIYEYSLDQEADFLDSYENVSELFLRLQQ
KFIDIRKRIVKFKHQTATRLFCIPTTSGTGSEVTPYAVITDDHTHVKYPLTDYELTPQVA
IVDPEFVMTVPKRTVALSGLDTLSHALEAYVSVMASDLTRPWSLEAIKLVIENLEDSYNY
DPKNPTLRGEQARENMHYAATLAGMAFSNAFLGINHSIAHKTGGEFGLPHGLAISIAMQH
VIRYNGVAGNVKRSVFPRYEEYRAQRDYADIARSLGLQGKDDAALVEALCQRIDALMKAV
DVDPRLSANGVTKEAFDAAVDKLASLAYDDQCTPANPRQPYIAELKQLLIDMF
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaacaaatgcagatgtaaagaatgacgagttgagcgcagaagaattggct
caacagtacactggagctcttgtcgaaaaagctcttgaagctgaacgtgtttatgcaact
tattcacaagaacaagttgataacattgtcgcagcgatggctcttgcaggttcagaagct
tcgcttgaattagcaaaagaagctcatgcagaaacgggtcgtggtgtcgttgaagataaa
gatattaagaaccacttcgctactgagtacgtttatgaacgtattaaaaatgaaaaaaca
gtaggtatcattggggaagataaggtttcaggaagtatccaaatcgcagcacctcttggt
gttttggctggtattgttccaacaacaaacccaacttcaacaacaatgttcaagattttg
gtagctcttaaaacacgtaatgcgattgtctttgctttccacccacaagcgcaaaactgt
tcagcacatgctgcacaaattctttatgatgccgcagtgaaagctggtgctccagaaaac
attgttcaatggattgaaacaccgtctcttgcaaatacatcagcgcttatccaaaatccg
aagattgcttctattttggcaactggtgggcctggtatggtaaatgccgctcttaaatca
ggtaacccatcaatgggtgttggtgctggtaacggtgctatctacgttgatgcaacagca
cacgttgatcgtgctgtagaagacttgttgctatcaaaacgttttgataacggtatgatt
tgtgccactgaaaactctgcagttgttgaagcaccaatctatgatgaatggcttcaaaaa
atgcaagataagggtgcctaccttgtgcctaagaaggactataaaaaactcgaagatttt
gtctttaatgacagacacggtgttaacggtccagttgctggtatgccagctcgttggatt
tgtgaacaagccggtgtgaaattgccagaaggtaaagatgttctcttatttgaacttgat
aagaaaaatatcggtgaaaaactatcttctgaaaaactttctccactcctttcagtttat
aaagctaaagatcgtgctgaaggtgttgaaattgttgaagcacttcttgactaccaaggt
gcaggacacaatgctggtattcaaattggttctcaagcagacccatttgttgctgaatat
ggcgacgctgtgaaagcatcacgtgtcttggttaaccaaccagattcagtcggaggtatt
ggtgatgtctacacagatgcacttaaagctagcttaacacttggaacaggatcatggggg
aaaaattcattgtcacacaatctttcaactggcgatctcttaaatgttaagacagttgcc
aaacgtcgcaaccgtcctcaatggattcgcctaccagaaaaaacttactacgaaaaaaat
gccatttcttacttgcaagatgaatacgaaccaatgcaacgcgctttgattgttgcagac
ccaggtatggttcaatttggttttgttgatactgttcttgctcaattggcattgcgtgat
gaaaaagttgcgacatcaatttacggcactatcaaaccagacccaacacttggtcaaaca
attgaaatcgcaaaacaaatgcgtgatttcaaaccagatacagttattgcagtcggtggt
ggttcagcacttgatgcggctaaaattgcacgttacatctatgaatactcacttgatcaa
gaagctgatttccttgacagctatgagaacgtcagcgaactcttcttacgtttgcaacaa
aaattcattgatatccgtaaacgtatcgtgaaattcaaacatcaaacagcaactcgtctc
ttctgtatcccaacaacatctggtacaggttcagaagtaacaccttacgctgttattact
gatgatcatactcacgttaaatatccattgactgactatgaattgacaccacaagttgct
attgttgacccagaatttgttatgaccgtgccaaaacgtacagtagctctttctggtctt
gatactttgtcacatgcccttgaagcttatgtttcagttatggcatctgatttgactcgt
ccatggtctcttgaagctattaaattagttatcgaaaacttggaagattcttataactac
gatcctaagaatcctacacttcgtggcgaacaagcacgtgaaaatatgcactatgctgca
acacttgcaggtatggccttctcaaatgccttcctaggtattaatcactcaatcgcacac
aaaactggtggtgaatttggtcttcctcatggtctagctatttcaatcgctatgcaacat
gttattcgttacaatggtgttgcaggaaatgtgaaacgttcagtcttcccacgttatgaa
gaatatcgtgcacaacgtgattacgctgatattgctcgtagccttggtcttcaaggtaaa
gatgatgcagcattagtagaagcgctttgccaacgtattgatgctttgatgaaagcagtt
gatgttgatccacgtctttctgcaaatggtgttacaaaagaagcctttgatgcagcagtt
gataaattagcatcacttgcatacgatgatcaatgtacacctgctaacccacgtcaacct
tacattgctgagttgaaacaattattgattgacatgttctaa

DBGET integrated database retrieval system