KEGG   Streptococcus infantarius: Sinf_0462Help
Entry
Sinf_0462         CDS       T01765                                 

Gene name
trpC
Definition
indol-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sif  Streptococcus infantarius
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinf_0462 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinf_0462 (trpC)
Enzymes [BR:sif01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sinf_0462 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486518..487285
Genome map
AA seq 255 aa AA seqDB search
MSKEFLPTILKQKEKEVASLELEPLQPLRETYKLYDYLKNNANKLQIIAEVKKASPSLGD
INLEVDIVKQAKIYQDSGAVMISVLTDLFFFKGDIDYLRQISNQVKIPTLAKDFIIDEKQ
IIRSRNAGATVILLIVAALSETRLKELYDFATGLGLEVLLETHNLAELEVAHRIGAKIIG
VNNRNLVTFETDINTSLELSTYFKEGPVYVSESAIFTKEDAELVAPFFNGILVGTALMTA
ENVAEKVKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaatttttaccaaccattttaaagcaaaaagaaaaagaagttgcctctcta
gaacttgagccactgcaacctcttcgtgagacttataagctctacgattacctaaaaaat
aatgcgaataagctgcaaattatcgctgaggtaaaaaaagccagtcccagtcttggtgac
attaatctcgaagttgatattgttaagcaagccaaaatttaccaagatagcggtgctgtg
atgatttctgttttgacagaccttttctttttcaagggggacattgattatcttcgtcag
atttcaaatcaagtaaaaattccaaccttggcaaaagattttatcatcgatgaaaaacag
attattcgtagtcgaaatgcaggagcaactgttattttactgattgtggcagctctttct
gagacgcgtttgaaagaactttatgactttgcaacaggattaggactagaagttctgctt
gaaacgcataacttagcagagttggaagtggctcatcgcattggtgctaagattatcgga
gttaacaatcgtaacttggtgacctttgaaacggatatcaatacaagcttggagctatca
acatattttaaagaaggtccagtttatgtttcagagtcagcgatttttactaaagaagat
gctgagctcgttgctccgtttttcaatggtattttagttggtacggctttaatgaccgct
gaaaatgtagccgagaaagtgaaggagttgcaaattgacaaaggttaa

DBGET integrated database retrieval system