KEGG   Streptococcus infantarius: Sinf_0462Help
Entry
Sinf_0462         CDS       T01765                                 

Gene name
trpC
Definition
(GenBank) indol-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sif  Streptococcus infantarius
Pathway
sif00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sif01100  Metabolic pathways
sif01110  Biosynthesis of secondary metabolites
sif01130  Biosynthesis of antibiotics
sif01230  Biosynthesis of amino acids
Module
sif_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinf_0462 (trpC)
Enzymes [BR:sif01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sinf_0462 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS SapB_1
Motif
Other DBs
NCBI-ProteinID: AEZ61815
UniProt: H6P8C5
Position
486518..487285
Genome map
AA seq 255 aa AA seqDB search
MSKEFLPTILKQKEKEVASLELEPLQPLRETYKLYDYLKNNANKLQIIAEVKKASPSLGD
INLEVDIVKQAKIYQDSGAVMISVLTDLFFFKGDIDYLRQISNQVKIPTLAKDFIIDEKQ
IIRSRNAGATVILLIVAALSETRLKELYDFATGLGLEVLLETHNLAELEVAHRIGAKIIG
VNNRNLVTFETDINTSLELSTYFKEGPVYVSESAIFTKEDAELVAPFFNGILVGTALMTA
ENVAEKVKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaatttttaccaaccattttaaagcaaaaagaaaaagaagttgcctctcta
gaacttgagccactgcaacctcttcgtgagacttataagctctacgattacctaaaaaat
aatgcgaataagctgcaaattatcgctgaggtaaaaaaagccagtcccagtcttggtgac
attaatctcgaagttgatattgttaagcaagccaaaatttaccaagatagcggtgctgtg
atgatttctgttttgacagaccttttctttttcaagggggacattgattatcttcgtcag
atttcaaatcaagtaaaaattccaaccttggcaaaagattttatcatcgatgaaaaacag
attattcgtagtcgaaatgcaggagcaactgttattttactgattgtggcagctctttct
gagacgcgtttgaaagaactttatgactttgcaacaggattaggactagaagttctgctt
gaaacgcataacttagcagagttggaagtggctcatcgcattggtgctaagattatcgga
gttaacaatcgtaacttggtgacctttgaaacggatatcaatacaagcttggagctatca
acatattttaaagaaggtccagtttatgtttcagagtcagcgatttttactaaagaagat
gctgagctcgttgctccgtttttcaatggtattttagttggtacggctttaatgaccgct
gaaaatgtagccgagaaagtgaaggagttgcaaattgacaaaggttaa

DBGET integrated database retrieval system