KEGG   Streptococcus infantarius: Sinf_0464Help
Entry
Sinf_0464         CDS       T01765                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase (beta subunit) (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sif  Streptococcus infantarius
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinf_0464 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinf_0464 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinf_0464 (trpB)
Enzymes [BR:sif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sinf_0464 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
487850..489052
Genome map
AA seq 400 aa AA seqDB search
MSYNQPDINGFYGKFGGQFVPETLMTAVIELDKAYREAKADPSFQVELDELLKNYVGRET
PLYYAERLTKHIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVHAVTDGSRVLKDAVNAALRA
WVANIEDTHYIMGSALGPAPFPEIVRDFQSVIGKEAKKQYAEISGGKLPDAVLACIGGGS
NAIGLFYPFVEDESVALYGAEAAGHGLDTEEHAATFVKGRPGILHGALMNVLQDRHGQIM
EAFSISAGLDYPGVGPEHCHFQDIGRATYDSITDKEALEAFMLLSRLEGIIPALESSHAV
ALTQKVAKELGPDKSIIVCLSGRGDKDVVQVKERLEAEGK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagctataaccaaccagatattaatggattttatggaaaattcggtggacagtttgtc
cctgaaacgctgatgacagccgttatcgaacttgataaagcttaccgcgaagcaaaagct
gacccaagttttcaagtagaacttgatgaactacttaaaaactatgttggacgtgaaaca
ccgctttattacgcagagcgcttaactaagcatatcggtggtgctaagatttaccttaaa
cgtgaagaccttaaccacactggtgctcacaaaatcaacaacgcccttggtcaagttctc
cttgcaaaacgcatgggtaaaaagaaaatcattgccgaaactggagctggtcaacacggt
gtggcaacagctacagcagctgcactttttgacatggaatgtactatttacatgggtgaa
gaagatgtcaaacgtcaagccctcaatgtttttcgtatggagctgctcggtgctaaagta
cacgctgtcacagatggttcacgtgttttgaaagacgctgttaatgcagctcttcgcgcg
tgggtagcaaatatcgaagatactcactatattatggggtcagcacttggacctgcacca
tttcctgaaatcgtacgtgacttccaatcagttattggtaaagaagctaaaaaacaatac
gcagaaatctcaggtggtaaactaccagatgctgttctagcttgtatcggtggtggctca
aatgcaatcggactcttttatccatttgttgaagatgaatctgttgccctttatggtgca
gaagctgcaggacatggtcttgatactgaagaacacgcagcaacttttgtcaaaggtcgt
ccaggcatcttgcatggagctttgatgaatgttctccaagaccgtcacggacaaatcatg
gaagctttctcaatttcagcaggtcttgattatcctggggttggtcctgaacactgtcac
ttccaagatatcggccgtgcaacctatgattcaattacggataaagaagcacttgaagca
tttatgcttttgtcacgacttgaagggattatcccagcgcttgaatcaagtcatgccgtt
gcccttactcaaaaagtggctaaagaacttggcccagacaaatcaattattgtttgtcta
tcaggacgtggagataaggatgttgttcaagtaaaagaacgtttggaagcagaagggaag
taa

DBGET integrated database retrieval system