KEGG   Streptococcus infantarius: Sinf_0465Help
Entry
Sinf_0465         CDS       T01765                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase (alpha subunit)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sif  Streptococcus infantarius
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinf_0465 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinf_0465 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinf_0465 (trpA)
Enzymes [BR:sif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sinf_0465 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
489056..489838
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLQKIKASGKGIFVPYIMAGDHDKGLDGLFETIDLLENSGASAIEVGIPWSDP
VADGPVIELAGQRSLAKGVNLTGIVEKLQEKTVEVPLVIMTYINPVYQYGIEKFVKDLAN
TSVKGLIIPDLPHEHENLIKPYLDNTDIALVPLVSLTTGIERQKTLCQNAEGFIYAVAIN
GVTGKTGNYRDDLDKHLANLEAVADIPVLTGFGVSTKADIERFNKVSDGVIVGTKIVRDL
HGGKADDVAAFVTYGSNYQK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacacttacaaaacatcttcaaaagattaaagctagcggcaaaggaattttt
gttccttacatcatggcaggtgaccatgataaaggtcttgatggtttatttgagacgatt
gatttattggaaaatagcggagcttctgccattgaagtggggattccatggtctgacccc
gtcgctgatggcccagttattgaattagctggtcaaagaagtcttgctaaaggcgttaat
ttgacaggaatcgttgaaaaattacaagaaaaaacagtcgaagtgcctttggtcattatg
acttacatcaatcctgtttatcaatatggcattgaaaaatttgttaaagatttggccaat
acctctgttaaaggtttgattattcctgacttgccacatgagcatgaaaatcttatcaag
ccataccttgataatacagatattgcccttgttccactggtcagcttgactactggcatt
gaacgtcagaaaactttgtgtcaaaacgctgaaggctttatctatgcggttgctatcaac
ggtgttacaggtaaaactggtaattatcgtgatgatttggataaacatttggcaaatctt
gaagctgttgctgacattccagtattaacgggatttggagtgtcaacaaaagctgatatc
gagcgttttaataaggtgtcagatggcgtcattgtcggaactaaaattgttcgagattta
cacggaggtaaagcagatgacgtcgcagcatttgtaacatatggctcaaattatcaaaaa
taa

DBGET integrated database retrieval system