KEGG   Streptococcus infantarius: Sinf_0470Help
Entry
Sinf_0470         CDS       T01765                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sif  Streptococcus infantarius
Pathway
sif00010  Glycolysis / Gluconeogenesis
sif00052  Galactose metabolism
sif00500  Starch and sucrose metabolism
sif00520  Amino sugar and nucleotide sugar metabolism
sif00521  Streptomycin biosynthesis
sif01100  Metabolic pathways
sif01110  Biosynthesis of secondary metabolites
sif01120  Microbial metabolism in diverse environments
sif01130  Biosynthesis of antibiotics
sif01200  Carbon metabolism
Module
sif_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sif_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinf_0470 (glcK)
   00052 Galactose metabolism
    Sinf_0470 (glcK)
   00500 Starch and sucrose metabolism
    Sinf_0470 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    Sinf_0470 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sinf_0470 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sinf_0470 (glcK)
Enzymes [BR:sif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sinf_0470 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AEZ61823
UniProt: H6P8D3
Position
492958..493926
Genome map
AA seq 322 aa AA seqDB search
MTKKLLGIDLGGTTIKFGILTLEGEVQEKWAIDTNTLEDGKHIVPDIVESIKHRLNLYGL
TKDDFAGIGMGSPGAVDRENKTVTGAFNLNWAHTEEVGSVIERELGIPFAIDNDANVAAL
GERWTGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMNIEPVDGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGDSKIKAAIDNGDVVTSKDIFVAAEAGDHFADSV
VEKVGFYLGQATANIANILNPDSVVIGGGVSAAGEFLRSRVEKYFVTYAFPQVRKTTRVK
IAELGNDAGIIGAASLASQFVD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaacttttagggattgacctaggtggaacaacgattaaattcggtatccta
actcttgaaggtgaagttcaagaaaaatgggcaatcgatacaaatacacttgaagatggt
aaacacatcgttcctgacatcgttgagtcaatcaaacaccgtttgaatctttatggtttg
acaaaagatgattttgcaggtatcggtatggggtcaccaggtgctgttgatcgtgaaaat
aaaactgttacaggtgcattcaacttgaactgggcacacactgaagaagttggttcagtt
attgaacgtgaacttggtattccatttgccatcgataacgatgctaacgttgccgcactt
ggtgaacgctggacaggtgctggtgctaacaaccctgatgttgttttcgtaacacttgga
actggtgttggtggtggtgttatcgctgacggtaaccttatccacggtgttgctggtgct
ggtggagaaattggtcacatgaatattgaaccagtcgatggtttcgaatgtacatgtggt
aataaaggatgtcttgaaacagttgcttcagcaacaggtgttgttcgtgtggctcgtcac
ttggcagaagaatatgaaggtgattcaaaaattaaagcagctatcgacaatggtgatgtt
gtaacaagtaaagatatctttgtagctgctgaagctggtgatcatttcgcagattcagtt
gttgaaaaagtaggtttctaccttggacaagcaactgcaaacatcgcaaacatcttgaac
ccagattcagttgttatcggtggtggtgtatctgctgcaggtgaattcttgcgtagccgt
gttgaaaaatacttcgttacttacgcattcccacaagttcgtaaaacaactagagtgaaa
atcgctgaacttggtaacgatgcaggtatcatcggtgctgcaagtcttgcaagtcaattc
gtagattaa

DBGET integrated database retrieval system