KEGG   Streptococcus infantarius: Sinf_0470Help
Entry
Sinf_0470         CDS       T01765                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sif  Streptococcus infantarius
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sinf_0470 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinf_0470 (glcK)
   00052 Galactose metabolism
    Sinf_0470 (glcK)
   00500 Starch and sucrose metabolism
    Sinf_0470 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    Sinf_0470 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sinf_0470 (glcK)
   00524 Butirosin and neomycin biosynthesis
    Sinf_0470 (glcK)
Enzymes [BR:sif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sinf_0470 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492958..493926
Genome map
AA seq 322 aa AA seqDB search
MTKKLLGIDLGGTTIKFGILTLEGEVQEKWAIDTNTLEDGKHIVPDIVESIKHRLNLYGL
TKDDFAGIGMGSPGAVDRENKTVTGAFNLNWAHTEEVGSVIERELGIPFAIDNDANVAAL
GERWTGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMNIEPVDGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGDSKIKAAIDNGDVVTSKDIFVAAEAGDHFADSV
VEKVGFYLGQATANIANILNPDSVVIGGGVSAAGEFLRSRVEKYFVTYAFPQVRKTTRVK
IAELGNDAGIIGAASLASQFVD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaacttttagggattgacctaggtggaacaacgattaaattcggtatccta
actcttgaaggtgaagttcaagaaaaatgggcaatcgatacaaatacacttgaagatggt
aaacacatcgttcctgacatcgttgagtcaatcaaacaccgtttgaatctttatggtttg
acaaaagatgattttgcaggtatcggtatggggtcaccaggtgctgttgatcgtgaaaat
aaaactgttacaggtgcattcaacttgaactgggcacacactgaagaagttggttcagtt
attgaacgtgaacttggtattccatttgccatcgataacgatgctaacgttgccgcactt
ggtgaacgctggacaggtgctggtgctaacaaccctgatgttgttttcgtaacacttgga
actggtgttggtggtggtgttatcgctgacggtaaccttatccacggtgttgctggtgct
ggtggagaaattggtcacatgaatattgaaccagtcgatggtttcgaatgtacatgtggt
aataaaggatgtcttgaaacagttgcttcagcaacaggtgttgttcgtgtggctcgtcac
ttggcagaagaatatgaaggtgattcaaaaattaaagcagctatcgacaatggtgatgtt
gtaacaagtaaagatatctttgtagctgctgaagctggtgatcatttcgcagattcagtt
gttgaaaaagtaggtttctaccttggacaagcaactgcaaacatcgcaaacatcttgaac
ccagattcagttgttatcggtggtggtgtatctgctgcaggtgaattcttgcgtagccgt
gttgaaaaatacttcgttacttacgcattcccacaagttcgtaaaacaactagagtgaaa
atcgctgaacttggtaacgatgcaggtatcatcggtgctgcaagtcttgcaagtcaattc
gtagattaa

DBGET integrated database retrieval system