KEGG   Streptococcus infantarius: Sinf_0523Help
Entry
Sinf_0523         CDS       T01765                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phospho glycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sif  Streptococcus infantarius
Pathway
sif00010  Glycolysis / Gluconeogenesis
sif00260  Glycine, serine and threonine metabolism
sif00680  Methane metabolism
sif01100  Metabolic pathways
sif01110  Biosynthesis of secondary metabolites
sif01120  Microbial metabolism in diverse environments
sif01130  Biosynthesis of antibiotics
sif01200  Carbon metabolism
sif01230  Biosynthesis of amino acids
Module
sif_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sif_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinf_0523 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Sinf_0523 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinf_0523 (gpmA)
Enzymes [BR:sif01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sinf_0523 (gpmA)
Membrane trafficking [BR:sif04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Sinf_0523 (gpmA)
Exosome [BR:sif04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sinf_0523 (gpmA)
  Exosomal proteins of melanoma cells
   Sinf_0523 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Imm70
Motif
Other DBs
NCBI-ProteinID: AEZ61876
UniProt: H6P9D5
Position
545851..546543
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLTEEGTKQATEAGKLIKEAGIEFDVAFTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGQNKAEAAEKWGDEQVHIWRRSYDVL
PPAMAKDDQYSAHTDRRYANLDDKVVPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNVTDEYFLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtgtttgcacgtcacggggaatctgaatggaacaaagctaaccttttc
actggttgggctgatgttgaccttacagaagaaggtactaaacaagctactgaagcaggt
aaattgatcaaagaagcaggaatcgaattcgatgttgctttcacttcagttcttaaacgt
gctatcaaaacaactaaccttgctcttgaagcttctgaccaactttgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtcaaaacaaagctgaa
gctgctgaaaaatggggtgacgaacaagttcacatctggcgtcgttcatacgatgtattg
ccaccagctatggctaaagacgatcaatactcagcacacactgatcgtcgttacgctaac
cttgatgacaaagttgttccagatgcagaaaacttgaaagttactttggaacgtgccctt
ccattctgggaagataaaatcgctccagctcttaaagatggtaagaacgtctttgtaggt
gctcacggtaactcaatccgcgctcttgtaaaacacatcaaacaattgtcagatgacgaa
attatggatgttgaaatccctaacttcccaccacttgtattcgaatttgacgaaaaattg
aacgttactgacgaatacttcttgggtaaataa

DBGET integrated database retrieval system