KEGG   Streptococcus infantarius: Sinf_0523Help
Entry
Sinf_0523         CDS       T01765                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phospho glycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sif  Streptococcus infantarius
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sinf_0523 (gpmA)
   01230 Biosynthesis of amino acids
    Sinf_0523 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinf_0523 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Sinf_0523 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinf_0523 (gpmA)
Enzymes [BR:sif01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sinf_0523 (gpmA)
Exosome [BR:sif04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sinf_0523 (gpmA)
  Exosomal proteins of melanoma cells
   Sinf_0523 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
545851..546543
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLTEEGTKQATEAGKLIKEAGIEFDVAFTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGQNKAEAAEKWGDEQVHIWRRSYDVL
PPAMAKDDQYSAHTDRRYANLDDKVVPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNVTDEYFLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtgtttgcacgtcacggggaatctgaatggaacaaagctaaccttttc
actggttgggctgatgttgaccttacagaagaaggtactaaacaagctactgaagcaggt
aaattgatcaaagaagcaggaatcgaattcgatgttgctttcacttcagttcttaaacgt
gctatcaaaacaactaaccttgctcttgaagcttctgaccaactttgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtcaaaacaaagctgaa
gctgctgaaaaatggggtgacgaacaagttcacatctggcgtcgttcatacgatgtattg
ccaccagctatggctaaagacgatcaatactcagcacacactgatcgtcgttacgctaac
cttgatgacaaagttgttccagatgcagaaaacttgaaagttactttggaacgtgccctt
ccattctgggaagataaaatcgctccagctcttaaagatggtaagaacgtctttgtaggt
gctcacggtaactcaatccgcgctcttgtaaaacacatcaaacaattgtcagatgacgaa
attatggatgttgaaatccctaacttcccaccacttgtattcgaatttgacgaaaaattg
aacgttactgacgaatacttcttgggtaaataa

DBGET integrated database retrieval system