KEGG   Streptococcus infantarius: Sinf_0527Help
Entry
Sinf_0527         CDS       T01765                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sif  Streptococcus infantarius
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sif03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
550256..550852
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFTKLPGIGIKTATRLAFYTIGMSDEDVNEFAKNLLAAKRELTYCSVC
GNLTDEDPCQICNDQTRDRSVILVVEDSKDVSAMEKIQEYHGLYHVLHGLISPMNGVGPD
DINLKSLITRLMDSEVSEVIIATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatccaacaccgattgcaaagctaattgatagttttacaaagttaccaggaata
gggataaaaacggcgacacgtttggccttttacacgattggtatgtctgatgaagacgtg
aatgaatttgctaaaaacttgttggctgcaaaacgagaattaacttattgttcagtgtgc
gggaatttgactgatgaagatccttgccaaatttgtaatgatcagacacgtgatcgttca
gtgattttggtggttgaggattcaaaagatgtctcagctatggaaaaaatccaagaatat
cacggactttatcatgtcttacacggacttatttcaccgatgaatggtgtcggtcctgat
gatattaatttgaagtcattgattacacgtttaatggatagtgaggttagtgaggttatt
attgcaaccaacgccaccgcagatggtgaagcaacatctatgtatatctcacgtgtccta
aaacctgcaggaatcaaagtaacacgcttggcgcgtggattagcggtaggttcagatatc
gaatatgccgatgaagttaccctacttcgtgctattgaaaaccgaacagaattgtag

DBGET integrated database retrieval system