KEGG   Streptococcus infantarius: Sinf_0620Help
Entry
Sinf_0620         CDS       T01765                                 

Gene name
murAA
Definition
UDP-N-acetylglucosamine1-carboxyvinyl transferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sif  Streptococcus infantarius
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sinf_0620 (murAA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sinf_0620 (murAA)
Enzymes [BR:sif01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Sinf_0620 (murAA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646714..647988
Genome map
AA seq 424 aa AA seqDB search
MDKIIIEGGNTRLEGEVIIEGAKNAVLPLLAATILPKEGKTVLTNVPILSDVFTMNNVVR
GLDIQVDFDEAKNTIEVDASGDILDIAPYEYVSKMRASIVVLGPILARKGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGAKITQAGGDITATVDGKLKGTTIYMDFPSVGATQNLMMAATL
AEGVTVIENVAREPEIVDLAMLLNKMGAIVKGAGTETLTITGVDSLHGAEHDVVQDRIEA
GTFMVAAAMTSGNVLVKDAIWEHNRPLISKLIEMGVTVIDEPEGIRVIADTAKLKPVTVK
TLPHPGFPTDMQAQFTALMAVVNGESTMIETVFENRFQHLEEMRRMGLQSEIMRDTAMIH
GGLDLQGAPVMSTDLRASAALILTGMVAKGTTTVGRLNHLDRGYYKFHEKLAKLGANIKR
ISEA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaattattattgaaggcggtaatacacgcctagaaggagaagtaatcattgaa
ggagcaaagaatgcggttcttcctcttcttgcagcgacaattttaccgaaggaaggaaag
acagttttaacaaatgtcccaatcctttcagatgtctttacgatgaataatgttgtccgt
ggtttagatattcaagttgattttgatgaagcaaagaacaccattgaagtggatgcctca
ggagatattttggatattgccccatatgaatatgttagcaaaatgcgtgcttcaatcgtt
gttttaggaccaattttagcgcgtaaaggtcatgcaaaagtatcaatgcctggtggctgc
acgattggtagtcgtccaattgaccttcaccttaaaggtttggaagctatgggggcaaaa
atcacacaagctggtggtgatatcacagcgactgtcgatgggaaacttaaagggacaaca
atttacatggatttcccatcagttggtgcaacacaaaacttgatgatggcagcaactttg
gcagaaggtgtgacagttattgaaaatgtagcacgtgagcctgaaatcgttgatttggct
atgttgcttaataaaatgggtgctatcgttaaaggtgccggtacagagactttgaccatt
actggtgttgatagccttcatggtgctgaacacgatgtggttcaagaccgtattgaagct
ggaactttcatggtagcggcagctatgacatcaggtaatgttcttgttaaggatgctatc
tgggaacacaatcgtcctttgatttcaaaattgattgagatgggtgtgaccgttattgat
gaacctgaagggattcgtgttattgctgatacagcaaaattgaaacctgtaacggttaaa
acacttcctcacccaggtttcccaactgatatgcaagcgcaatttacagctttgatggca
gttgtcaatggcgaatcaacaatgattgaaacagtctttgagaatcgtttccaacatttg
gaagaaatgcgccgtatgggcttgcagtcagaaatcatgcgcgatacagctatgattcat
ggtgggctagatcttcaaggtgctccagttatgtcaactgaccttcgtgctagcgcagcc
cttattttgacaggtatggtggcaaaaggaacaacaacagttggtcgcttgaatcacctt
gaccgtggatattacaaattccatgaaaaattggctaaactcggtgcaaatattaaacgt
ataagtgaggcttaa

DBGET integrated database retrieval system