KEGG   Streptococcus infantarius: Sinf_0647Help
Entry
Sinf_0647         CDS       T01765                                 

Gene name
rmlC
Definition
dTDP 4-keto 6-deoxyglucose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sif  Streptococcus infantarius
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sinf_0647 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sinf_0647 (rmlC)
Enzymes [BR:sif01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Sinf_0647 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677161..677757
Genome map
AA seq 198 aa AA seqDB search
MTEQFFGKELAARKIEAIPGMIEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKL
QNNVSFSHKNVLRGLHAEPWDKYISVADEGKVLGSWVDLREGDSFGHVYQTVIDASKGIF
VPRGVANGFQVLSDKVSYSYLVNDYWALELKPKYAFVNYADPTLGIKWENLEEAEVSEAD
KNHPLLKDVKPLSKDDLN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacagttttttggtaaagaattagcagcacgtaaaatcgaagccatcccagga
atgattgaatttgatattcctgttcacggtgacaaccgcggatggtttaaagaaaacttc
caaaaagaaaaaatgcttcctcttggttttccagaatcattctttgcagaaggaaaatta
caaaataacgttagcttttcacataaaaacgttttgcgtggacttcacgcagaaccttgg
gacaaatacatctcagttgctgacgaaggtaaagtactaggttcatgggttgacttacgt
gaaggtgacagctttggtcatgtttaccaaacagttatcgatgcttcaaaaggtatcttt
gtcccgcgtggtgtcgctaacggtttccaagtattgtctgataaagtatcatacagctac
ttggttaacgactactgggcacttgaacttaaaccaaaatacgcttttgtaaactatgca
gatccaactcttggtatcaaatgggaaaacttggaagaagcagaagtttctgaagcagat
aaaaatcacccactacttaaagatgttaaacctttaagtaaagatgatttgaactaa

DBGET integrated database retrieval system