KEGG   Streptococcus infantarius: Sinf_0754Help
Entry
Sinf_0754         CDS       T01765                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sif  Streptococcus infantarius
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sinf_0754 (pfkA)
   01230 Biosynthesis of amino acids
    Sinf_0754 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinf_0754 (pfkA)
   00030 Pentose phosphate pathway
    Sinf_0754 (pfkA)
   00051 Fructose and mannose metabolism
    Sinf_0754 (pfkA)
   00052 Galactose metabolism
    Sinf_0754 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Sinf_0754 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Sinf_0754 (pfkA)
Enzymes [BR:sif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sinf_0754 (pfkA)
Protein phosphatases and associated proteins [BR:sif01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sinf_0754 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
789727..790743
Genome map
AA seq 338 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAIKEGMEVFGINRGYAGMVDGDIFPLDTQSVSNI
LSHGGTFLQSARYPEFATLEGQLAGIEQLKKHDIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAMEALDKIRDTSYSHKRTFVVEVMGRNAGDIALWA
GIAAGADQIIIPEEEYDINEVVAKVKDGYENKGKERHLIVLAEGVMHAEKFAELMKESGD
TSDLRATNLGHILRGGAPSPRDRVLASWMGAHAVELLQQGRGGLAVGIHNEELVESPILG
TKEEGALFSLAEDGSIIVNMPHKARLDFAQLNRDIAHL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggcggcgacgctcctggtatgaatgctgctgtt
cgtgcggttgttcgtaaagcaattaaagaaggaatggaagtcttcggaatcaaccgtggt
tatgctggtatggtcgatggcgacattttcccattggatactcaaagtgtttcaaacatt
ttgtcacatggtggtactttccttcaatcagctcgttaccctgagtttgcaactcttgaa
ggacaacttgctggtatcgaacaacttaaaaaacacgatatcgaaggtgtcgttgttatc
ggtggtgacggttcttatcacggtgctatgcgcttgacagaacacggattcccagcagtt
ggtatcccaggtacaatcgataacgatatcgctggtacagattacactattgggtttgat
acagctgtaaacacagctatggaagctcttgacaaaatccgtgatacatcttacagtcac
aaacgtacatttgttgttgaagtaatgggacgtaacgctggtgatatcgctctttgggca
ggtattgctgcaggtgctgaccaaatcattattcctgaagaagaatatgacatcaacgaa
gttgttgcaaaagttaaagatggttacgaaaacaaaggtaaagaacgtcaccttatcgtt
cttgctgaaggtgtaatgcatgctgaaaaatttgcagagttgatgaaagaatctggtgat
actagcgaccttcgcgcaactaaccttggtcacatccttcgtggtggtgcaccatcacct
cgtgatcgtgttcttgcttcttggatgggtgctcacgctgttgaattgcttcaacaaggt
cgtggtggacttgccgttggtatccacaacgaagaattagtagaaagcccaattcttggt
actaaagaagaaggtgctctattctcattggcagaagatggtagcattatcgtcaacatg
ccacacaaagcacgtcttgactttgctcaattaaatcgagacattgctcatttgtaa

DBGET integrated database retrieval system