KEGG   Streptococcus infantarius: Sinf_0754Help
Entry
Sinf_0754         CDS       T01765                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase (PFK)
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sif  Streptococcus infantarius
Pathway
sif00010  Glycolysis / Gluconeogenesis
sif00030  Pentose phosphate pathway
sif00051  Fructose and mannose metabolism
sif00052  Galactose metabolism
sif00680  Methane metabolism
sif01100  Metabolic pathways
sif01110  Biosynthesis of secondary metabolites
sif01120  Microbial metabolism in diverse environments
sif01130  Biosynthesis of antibiotics
sif01200  Carbon metabolism
sif01230  Biosynthesis of amino acids
sif03018  RNA degradation
Module
sif_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinf_0754 (pfkA)
   00030 Pentose phosphate pathway
    Sinf_0754 (pfkA)
   00051 Fructose and mannose metabolism
    Sinf_0754 (pfkA)
   00052 Galactose metabolism
    Sinf_0754 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Sinf_0754 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Sinf_0754 (pfkA)
Enzymes [BR:sif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sinf_0754 (pfkA)
Protein phosphatases and associated proteins [BR:sif01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sinf_0754 (pfkA)
Messenger RNA biogenesis [BR:sif03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Sinf_0754 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEZ62095
UniProt: H6P9K4
Position
789727..790743
Genome map
AA seq 338 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAIKEGMEVFGINRGYAGMVDGDIFPLDTQSVSNI
LSHGGTFLQSARYPEFATLEGQLAGIEQLKKHDIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAMEALDKIRDTSYSHKRTFVVEVMGRNAGDIALWA
GIAAGADQIIIPEEEYDINEVVAKVKDGYENKGKERHLIVLAEGVMHAEKFAELMKESGD
TSDLRATNLGHILRGGAPSPRDRVLASWMGAHAVELLQQGRGGLAVGIHNEELVESPILG
TKEEGALFSLAEDGSIIVNMPHKARLDFAQLNRDIAHL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggcggcgacgctcctggtatgaatgctgctgtt
cgtgcggttgttcgtaaagcaattaaagaaggaatggaagtcttcggaatcaaccgtggt
tatgctggtatggtcgatggcgacattttcccattggatactcaaagtgtttcaaacatt
ttgtcacatggtggtactttccttcaatcagctcgttaccctgagtttgcaactcttgaa
ggacaacttgctggtatcgaacaacttaaaaaacacgatatcgaaggtgtcgttgttatc
ggtggtgacggttcttatcacggtgctatgcgcttgacagaacacggattcccagcagtt
ggtatcccaggtacaatcgataacgatatcgctggtacagattacactattgggtttgat
acagctgtaaacacagctatggaagctcttgacaaaatccgtgatacatcttacagtcac
aaacgtacatttgttgttgaagtaatgggacgtaacgctggtgatatcgctctttgggca
ggtattgctgcaggtgctgaccaaatcattattcctgaagaagaatatgacatcaacgaa
gttgttgcaaaagttaaagatggttacgaaaacaaaggtaaagaacgtcaccttatcgtt
cttgctgaaggtgtaatgcatgctgaaaaatttgcagagttgatgaaagaatctggtgat
actagcgaccttcgcgcaactaaccttggtcacatccttcgtggtggtgcaccatcacct
cgtgatcgtgttcttgcttcttggatgggtgctcacgctgttgaattgcttcaacaaggt
cgtggtggacttgccgttggtatccacaacgaagaattagtagaaagcccaattcttggt
actaaagaagaaggtgctctattctcattggcagaagatggtagcattatcgtcaacatg
ccacacaaagcacgtcttgactttgctcaattaaatcgagacattgctcatttgtaa

DBGET integrated database retrieval system