KEGG   Streptococcus infantarius: Sinf_1027Help
Entry
Sinf_1027         CDS       T01765                                 

Definition
beta-glucosidase (glycoside hydrolase, family1) (EC:3.2.1.86 3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sif  Streptococcus infantarius
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinf_1027
Enzymes [BR:sif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Sinf_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1055582..1057084)
Genome map
AA seq 500 aa AA seqDB search
MTKAFPKNFLWGGAIAANQAEGAYNEDGRGLVATDVTTGGSVNAPRYMTYIDKDGNPGKA
PAMGHNGKIPEGAKYAVLDTEHYPNHVAVDFYHRYKEDIKLFAEMGYSVFRLSISWARIF
PNGDDKEPNQAGLDFYRSVFEECRKYNIEPLVSIWHFDTPLALEENYGGWKNRKLIDFYV
RYCEVIFNEYKDLVKYWLTFNEINNTTMFLDMFGSKASDADYQEGYQILHHQFVASAKAV
QIGHAINPDFMVGNMICGITFYPGTCDPADILANEHKWQSGIYYCGDVQAKGKYGTYAKR
LWKEHNVELDITEEDLEDLKRGTVDMYTFSYYMSNNVTTHTGGEQVSGNFSAGAKNPYLT
YSDWGWAHDPVGLQYYLEKIYDRYEIPLMVVENGLGAFDTVEEDGSIHDDYRIDYHRAHI
NAMANAIDNGVDLIGYTTWGCIDIVSAGTGEMRKRYGFIHVDMDDEGNGTLNRTPKDSFY
WYKEVISTNGQKAIDEASEY
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagcatttccaaaaaacttcctttggggcggagcaattgctgctaaccaagcc
gaaggtgcttataacgaagatggtcgaggacttgttgcaactgatgtgacaactggtggg
tcagtaaatgcgccacgttacatgacttatatcgacaaagatggtaaccctggtaaagcg
ccagctatgggacataatggtaagattcctgaaggcgctaaatatgccgtgctcgataca
gagcattatccaaaccatgtggctgttgatttttatcaccgttacaaagaagacatcaag
ttgtttgctgaaatgggctactctgtttttcgtttgtcaatttcttgggctcgtattttt
ccaaatggtgatgacaaagaacctaaccaagcagggcttgatttctaccgttcagtcttt
gaagaatgccgcaaatacaatattgaacctttggtttcaatttggcattttgatacgcca
ttagcacttgaagaaaattatggcggttggaaaaatcgtaagctgattgatttttatgtc
cgttattgtgaggttatttttaacgaatacaaagacttggttaaatactggttgactttc
aatgaaatcaataatacaaccatgttccttgatatgtttggctcaaaagccagtgatgct
gactatcaagaaggttatcaaattcttcaccatcaatttgtagcatcagctaaggctgta
caaattgggcatgccattaaccctgatttcatggttggaaatatgatttgtggtattaca
ttctatcccggaacttgtgatccagcagatatccttgctaatgaacacaaatggcaatca
ggtatttactattgtggtgatgtccaagctaaaggaaaatacggtacctatgccaaacgt
ctctggaaagaacacaatgttgaattggatattacagaagaagaccttgaagatttgaaa
cgtggaacagttgatatgtatactttctcatattacatgtctaacaacgtgacaactcat
actggtggtgagcaagtttcaggtaacttctcagctggtgctaagaatccatacttgacg
tattctgattggggttgggcgcatgacccagtgggacttcaatattatcttgaaaaaatc
tatgaccgttatgaaatcccattgatggttgttgaaaatggtcttggagcctttgatact
gttgaagaagatggctcaattcacgatgattatcgcattgattatcatcgtgcacatatt
aatgccatggcaaatgctattgacaacggtgttgaccttattggttacactacgtggggt
tgtatcgatatcgtctcagctggtacaggtgaaatgcgtaaacgctacggattcattcat
gtagatatggatgatgaaggcaatggaaccctaaatcgcacaccaaaagacagtttctac
tggtataaagaagttatttcaacaaatggccaaaaagccattgatgaagcaagtgaatat
taa

DBGET integrated database retrieval system