KEGG   Streptococcus infantarius: Sinf_1210Help
Entry
Sinf_1210         CDS       T01765                                 

Gene name
malQ
Definition
4-alpha-glucano transferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sif  Streptococcus infantarius
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sinf_1210 (malQ)
Enzymes [BR:sif01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Sinf_1210 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1232613..1234115)
Genome map
AA seq 500 aa AA seqDB search
MEKRASGVLMHITSLPGKQGVGTFGQEAYNFVDFLVETDQTYWQILPLTTTSYGDSPYQS
FSATAGNTHLIDLELLCKQGYLEKEDFEIVNFGDDLENVDYARIFEARRPILEKAVAEFM
QNSDNQKALAEFEKETSWVKDYAEFMAIKEFFGNKALQEWDDKAVVRREEAALDAYREKL
KDAITYHKVTQYFFYQQWADLKAYANEKGIKIIGDMPIYISADSVEVWTMPELFKVDAEK
NPLCIAGVPADSFSDDGQLWGNPIYDWENHKKTNYAWWVYRIKEGIKLYDLLRIDHFKGF
SDYWEIRGDYETANDGSWQPGPGRALFDVVRDELGELPIIAENLGYIDAKAEQLLTDTAF
PGMKILEFGFYDTEGKSIDAPHNCNKNSVAYNGTHDNEVVNGWYDNLTDEQKAFVDAYTH
RHEGEPITQTMLRTLFATVSDIAIATMQDILDKSAESRMNIPNTVGGNWQWRMLKEDLTD
ERKAFLKDITALYCRKNTFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacgtgcaagtggtgtactgatgcatatcacatcattacccggcaaacaaggg
gtgggaacatttggtcaagaagcttataactttgttgatttcttggttgaaactgaccaa
acatattggcaaatcctaccattaacaacgacaagttatggtgattccccttatcaatca
ttctcagcaacagctgggaacacacatttaattgacttagaattgctttgtaaacaaggt
tacttggaaaaagaagattttgaaatagttaacttcggagatgatttagaaaacgtagat
tatgctcgtatcttcgaagcacgacgtccaattttggagaaagcagttgcagaatttatg
caaaattctgataaccaaaaagctttagctgagtttgaaaaagaaacaagttgggtaaaa
gattacgcagaattcatggcaatcaaagagttctttggaaataaagctttgcaagaatgg
gatgataaagcagttgttcgccgtgaagaggcagctcttgatgcttatcgcgaaaaacta
aaagatgcgattacttatcataaagtcactcaatatttcttctaccaacaatgggctgat
ttaaaagcttatgctaatgaaaaaggcattaagattattggtgatatgccaatctacatt
tctgctgatagtgtagaggtttggacaatgcctgaacttttcaaagttgatgctgaaaag
aacccactttgtattgctggtgttcctgcggattcatttagtgatgatggtcaactttgg
ggaaatccaatttatgattgggaaaaccacaagaaaacaaattatgcttggtgggtttac
cgtattaaagaggggattaagctctacgaccttcttcgtattgaccactttaaaggtttc
tcagattattgggaaattcgtggcgattacgaaactgcaaatgatggtagctggcaacct
ggtccaggacgcgctttgtttgatgtcgtacgtgacgagcttggcgaacttcctattatt
gcagaaaacctcggttatattgatgccaaagctgagcaattgttaactgacaccgctttt
ccaggtatgaagattcttgaatttggtttctatgataccgaaggtaagagtatcgatgct
ccacataactgcaataaaaatagcgttgcttataatggcacacatgataatgaagtggtt
aatggttggtatgacaacttgactgatgaacaaaaagcatttgttgatgcttatacacat
cgtcatgaaggcgaaccaatcacacaaacaatgcttcgtaccttgtttgcaacggttagt
gatattgcaattgcaactatgcaagacatactagataaatcagctgagtctcgcatgaac
attccaaatactgttggtggcaactggcaatggcgtatgttaaaagaagatttgacagat
gaacgcaaagcattcttgaaagacattacagcactatattgccgcaaaaatacatttaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system