KEGG   Streptococcus infantarius: Sinf_1264Help
Entry
Sinf_1264         CDS       T01765                                 

Definition
mur ligase family protein (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sif  Streptococcus infantarius
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sinf_1264
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sinf_1264
Enzymes [BR:sif01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sinf_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1287922..1289247
Genome map
AA seq 441 aa AA seqDB search
MGITAGKAAHAILSKMGRGSTLPGKIALKFDKDILDTIAKDYEIVVVTGTNGKTLTTALT
VGILREAFGEIVTNPSGANMITGITSTFLTDKRGKSGKKIAVLEIDEASLPKITEYITPS
LFVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPNATILANGDSPLFNSTNVINPVKYYGF
DTEKHAPELAHYNTEGILCPQCQSILKYKLNTYANLGDYVCENCGFHRPKLDYALTDLTK
ITNTTSEFVIDGQDYKINVGGLYNIYNALAAVSVAEFFGVSPEKIKAGFDKSRAVFGRQE
TFKIGDKSCTLVLIKNPVGASQALDMIKLAPYPFTLSVLLNANYADGIDTSWIWDANFES
ILDMDIPQAFAGGVRHSEIARRLRVTGYDEDKITEAESLEDIMALIEAQPTDHAYILATY
TAMLQFREILASRHAVGKEMN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggaattacggctggtaaagcagctcacgccattctttcaaaaatgggacgtggctca
accttacctggaaaaatcgccctcaaattcgacaaagacattttagatacgattgccaaa
gattatgagattgttgttgtcactggtacaaacggtaaaaccctcacgactgctttaaca
gtaggtattttgcgtgaggctttcggtgaaatcgtgacaaaccctagtggagctaacatg
attaccggaatcacatcaactttcttgacagataaaagaggtaaatctggaaaaaaaatc
gctgtgctagaaattgatgaagcaagccttccaaaaatcacagaatacatcactccaagt
ctttttgtcttcacaaatatttttcgtgaccaaatggaccgttatggtgaaatctataca
acttatcaaatgattttggatggtgcagcaaaagccccaaatgcaactatcctagctaat
ggagacagcccactcttcaattcaacaaacgtcatcaatccagtcaaatactatggtttt
gatactgaaaagcatgcaccagaattagctcactacaacactgaaggtatcttgtgccca
caatgccaaagcatcttgaaatacaagcttaacacttacgctaaccttggtgattacgtt
tgtgaaaattgcggtttccaccgtccaaaacttgattatgctttgacagatttgacaaaa
atcacgaatactacatctgaatttgtcattgatgggcaagattacaagattaacgtcggt
ggtctttacaatatctataacgcccttgcagccgtatctgtagctgagttctttggagtt
tctcctgaaaaaatcaaagctggttttgacaagagccgtgcagtctttggacgtcaagaa
accttcaaaatcggtgataaatcttgtactttggttcttatcaaaaacccagttggtgct
agccaagctcttgatatgattaaattggctccatatccatttacactatcagttctactc
aatgccaactacgctgacggaattgatactagctggatttgggatgctaactttgaatct
atcttagacatggatattccacaagcctttgctggaggcgtgcgccactctgaaattgca
cgtcgcttacgtgtgacaggttatgatgaagataaaattacagaagctgaaagcttagaa
gatatcatggctttgattgaagctcaaccaactgaccatgcttacatcttagcgacttac
acagctatgcttcaattccgcgaaatcttagcaagtcgtcacgctgttggaaaggagatg
aactaa

DBGET integrated database retrieval system