KEGG   Streptococcus infantarius: Sinf_1331Help
Entry
Sinf_1331         CDS       T01765                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sif  Streptococcus infantarius
Pathway
sif00010  Glycolysis / Gluconeogenesis
sif00051  Fructose and mannose metabolism
sif00562  Inositol phosphate metabolism
sif01100  Metabolic pathways
sif01110  Biosynthesis of secondary metabolites
sif01120  Microbial metabolism in diverse environments
sif01130  Biosynthesis of antibiotics
sif01200  Carbon metabolism
sif01230  Biosynthesis of amino acids
Module
sif_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sif_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinf_1331 (tpi)
   00051 Fructose and mannose metabolism
    Sinf_1331 (tpi)
   00562 Inositol phosphate metabolism
    Sinf_1331 (tpi)
Enzymes [BR:sif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sinf_1331 (tpi)
Exosome [BR:sif04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sinf_1331 (tpi)
  Exosomal proteins of bladder cancer cells
   Sinf_1331 (tpi)
  Exosomal proteins of melanoma cells
   Sinf_1331 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEZ62643
UniProt: H6P9A6
Position
complement(1362235..1362993)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSELVEAGIAAPALDLSTVLAAAKGSNL
KVAAQNCYFENAGAFTGENSPKVLSEMGTDYVVIGHSERREYFHETDEDINKKAKAIFAN
GMLPIICCGETLETYEAGKAAEFVGGQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDTVAADFGQAVADKVRVQYGGSVKPENVAAYMACPDVDGALVGGASLQ
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagtagcttctaaattgccttcatcagaacttgttgaagctggt
atcgcagctcctgcacttgacctttcaacagttcttgctgcagctaaaggttcaaacctt
aaagttgctgctcaaaactgctactttgaaaacgctggtgctttcactggtgaaaacagc
cctaaagtattgtctgaaatgggaactgactacgttgtaattggtcactcagaacgtcgt
gaatacttccacgaaactgacgaagatatcaacaaaaaagctaaagcaatctttgctaat
ggtatgcttccaatcatctgctgtggtgaaactcttgaaacttacgaagctggtaaagct
gctgaattcgtaggtggacaagtttcagctgctcttgctggattgtcagaagaacaagtt
tcttcacttgttattgcatacgaaccaatctgggctatcggtactggtaaatcagctagc
caagatgacgcacaaaaaatgtgtaaagtagttcgtgacacagttgcagctgattttggt
caagcagtagctgataaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagcttacatggcttgcccagacgttgatggtgcccttgttggtggtgcatcacttcaa
ccagaaagcttccttgctcttcttgactttgtaaaataa

DBGET integrated database retrieval system