KEGG   Streptococcus infantarius: Sinf_1661Help
Entry
Sinf_1661         CDS       T01765                                 

Definition
exo-deoxyribonuclease V alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sif  Streptococcus infantarius
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sif00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sinf_1661
Enzymes [BR:sif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sinf_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1682105..1684573
Genome map
AA seq 822 aa AA seqDB search
MEYFFSGAIDRIIFENASNFFKIILLEIEDTDSDFDDFEIIVTGTITDVIEGENYTFWGE
LTQHPKYGEQLKVTRYERTKPTSSGLIKYFSSDNFKGIGKKTAEKIVQLYGDNTIDKILE
DPSKLESISGLSKENRDNFVAKLKLNYGTEQILSKLAEYGLTNRVAIDIFNHYKEESLEI
IQENPYQLVEDIQGIGFKIADQLAEQLGIEADAPQRFRAALVHSLFETSVENGDTYVEAR
DLLENTITILEEARQIELDPAAVAKELSTLIAEDKVQNIGTKIFDNTLFYAEAGIKKNLT
RILDTPLTKQFSDQDLQEEIEDIEDTFGISYDAVQKNAIKEALQSKVFILTGGPGTGKTT
VINGLIAAYADLHGIDLEKKDIPIVLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMDDYLDCDLIIIDEFSMVDTWLANQLFSSISSNTQVIIVGDSDQLPSVGPGQVLADLL
KIKTLPQIVLTKIFRQSEDSTIVTLANQMRQGILPADFTQKKADRSYFEAGAQYIPEMIP
KIVSAAIKSGISPQEIQILAPMYRGAAGINRLNTIIQDLLNPLGDQLSFAFGDMSFRKGD
KVLHLINDAELNVFNGDIGYITDLIPAKYTESKQDELYMSFDGTEVIYPRNEWHKITLAY
AMSIHKSQGSEFQVVILPITHQSRRLLQRNLIYTAITRSKSKLVMLGEIAAFDYAIKNEG
SKRKTYLVQRFTTNPEDLDNSETIENPDEAKESQNEPLEDKAISSSAHIEEEKSEKVVQL
SLDFNEDKPDNVKEYRLTEENLPFIDPMIGITQEDIEQFFKK
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttcttttctggcgctatcgaccgtattatttttgaaaatgccagtaacttt
tttaaaatcatattactcgaaatcgaagataccgattctgactttgatgattttgaaatc
attgtcacaggaaccattactgatgtcatcgaaggcgaaaattacaccttctggggagaa
ttaacccagcatccaaaatatggtgaacagctaaaagttacccgatacgagcgaacaaaa
ccaacctcttctggactcatcaagtacttttcaagtgacaactttaaaggcatcggtaaa
aagacagctgagaaaattgtccaactctacggcgataacacgattgataaaatcttggaa
gatcctagtaagcttgagagtatttctggactctctaaagaaaatcgtgataattttgtt
gccaaattaaaacttaactatggaactgagcaaatcctctcaaaacttgccgaatacggc
ttaaccaatcgtgtggctattgatattttcaatcattataaggaagaaagtttagagatt
atccaagaaaatccttatcaactggtcgaagatattcaaggtatcggctttaaaattgcg
gaccagctcgccgaacaattgggcattgaggcagatgcaccgcagcgtttccgtgccgca
ctcgttcacagcttatttgaaacctcggttgaaaatggggatacttacgttgaggcgcgt
gatttactagaaaatactattaccattttggaagaagcccgccaaattgagctagaccct
gctgctgttgctaaagaattatctacgcttatcgctgaagacaaggtgcaaaacatcggc
acaaaaatctttgataacacactgttttatgccgaagctggtatcaagaaaaatctaaca
cgcatccttgacactccattaactaaacaattttcagaccaagacttacaagaagaaatt
gaagatatcgaagacacctttggtatttcttatgacgctgtccaaaaaaatgccattaaa
gaagctcttcaaagcaaagttttcattctaactggtggaccagggactggtaaaacaact
gttattaacggtttgattgctgcttatgctgatttacacggcattgatttagagaagaag
gatatcccaattgttcttgctgcaccaacaggtcgcgcggcacgtcgcatgaacgaatta
actgggcttccaagtgcaaccatccaccgtcatcttggcttaaacggcgacaatgattat
caagccatggatgattatttggactgtgatttgattatcatcgatgaattttcaatggta
gatacttggctagccaatcagctctttagctccatttcatcaaatactcaagtcattatc
gttggtgatagcgaccaacttccatccgttggccctgggcaagtgctagctgatttactt
aaaatcaaaacactgccgcaaatagtactgacaaaaatctttaggcaatctgaagactca
accattgtcacactagctaatcagatgagacaaggcatcttgccagctgatttcactcag
aaaaaagcggaccgttcttactttgaagctggcgctcaatatattcctgagatgattccg
aaaattgtcagcgcagctattaaaagtggcattagccctcaagaaattcaaattcttgcg
cctatgtaccgtggtgctgccggcattaaccgcctcaatacaatcattcaagatttgctt
aatccactcggtgaccaattatcctttgcttttggtgatatgagtttccgtaagggggac
aaagttcttcatttgattaatgatgccgagctcaatgtctttaacggagacatcggctat
atcacagacttgattcctgccaaatacactgaatcaaaacaagatgaactctacatgtct
tttgacgggactgaagtgatttaccctcgtaacgaatggcacaaaatcacgcttgcctac
gccatgtccattcacaaatcacaagggagtgaattccaagtagttattctgccaattacg
caccaaagtcgtcgtcttttgcaacgcaatctgatttacacagctattacccgctctaag
agtaaattagtcatgttgggagagattgctgcctttgattacgccataaaaaatgaaggc
tctaaacgcaagacttatctcgtccaacgcttcacaacaaatccagaagaccttgacaac
tcagaaacgatagaaaatccagacgaagcaaaagaaagccaaaatgagccactagaagat
aaagcaatttcttcttctgctcacattgaagaagaaaaatccgaaaaagttgttcaactt
agccttgattttaacgaagacaaaccagataacgtcaaagaataccgtctaacagaagaa
aatcttccatttattgatccaatgattggtatcactcaagaagatatcgaacaatttttc
aaaaagtaa

DBGET integrated database retrieval system