KEGG   Streptococcus infantarius: Sinf_1827Help
Entry
Sinf_1827         CDS       T01765                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sif  Streptococcus infantarius
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sif00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1854176..1855633)
Genome map
AA seq 485 aa AA seqDB search
MPKKIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFVIRIEDTDRKRHVEDGERSQL
ENLKWLGMDWDESPQTHEKYRQSERLDIYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEFLGMSEEEKAAYIAEREAKGIIPTVRLAVNESGIYKWHDIVKGDIEFEG
GNVGGDWVIQKKDGYPTYNFAVVIDDHLMEISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDEHRLSKSPAAFDQKKMDWMSNEYIKNADFDTVFAMAKPFLEEAGRLTDKAEK
LVELYKPQMKSVDEIIPLTDLFFEDFPELTDAEKEFMAGETVPTVLEAFKAKLEAMSDED
FKSENIFSQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIYLLGREKSIEHIENM
LKNLK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagaaaattcgcgtgcgttatgcaccaagtccaacaggacttttacacatcgga
aatgcgcgtacagcgctctttaattatctttacgctcgtcaccacggtggtgattttgta
atccgtatcgaagatactgaccgtaaacgtcatgtcgaagacggtgaacgttcacaattg
gaaaaccttaaatggttgggaatggattgggacgaaagcccacaaactcacgaaaaatat
cgccaatcagaacgtttggacatctaccaaaaatacatcgaccaattgctagctgaaggt
aaagcttataaatcatacgttactgaagaagaactagctgcagaacgtgaacgccaagaa
gctgctggtgaaacacctcgttacatcaacgaattccttggtatgtctgaagaagaaaaa
gctgcttatatcgcagaacgtgaagcaaaaggaatcatccctactgtacgtttggccgtt
aacgaatcaggtatctacaaatggcatgatatcgttaaaggcgacatcgaatttgaaggt
ggaaacgtcggtggtgactgggttatccagaaaaaagatggttacccaacatacaacttt
gccgttgttatcgatgaccacttgatggaaatctctcacgttatccgtggagatgatcac
atcgcaaacacaccaaaacaattgatggtttacgaagcacttggttgggaagcaccagaa
ttcggtcacatgacattgattatcaactctgaaactggtaaaaaattgtcaaaacgtgac
actaacacacttcaattcatcgaagactaccgtaaaaaaggttacatgccagaagcagta
ttcaactttatcgctcttcttggttggaaccctggtggtgaagatgaaatcttctcacgt
gaagaattgatcaaactctttgatgaacaccgtttgagtaaatctccagctgcatttgac
caaaagaaaatggactggatgagcaacgaatacatcaagaatgcagatttcgatacagtc
tttgcaatggctaaaccattcttggaagaagctggtcgtttgactgacaaagctgaaaaa
ttggttgaactttacaaaccacaaatgaaatctgttgatgaaatcattccattgactgat
ttgttctttgaagatttcccagaattgacagatgctgaaaaagaattcatggctggtgaa
acagttccaacagttcttgaagccttcaaagcaaaacttgaagctatgagtgacgaagat
ttcaaatcagaaaacatcttctcacaaatcaaagctgttcaaaaagaaactggtatcaaa
ggtaaaaacctcttcatgccaattcgtatcgccgtttcaggtgaaatgcacggtccagaa
cttccagatactatctatcttcttggtcgtgaaaaatcaattgaacacattgaaaacatg
cttaaaaacttgaaataa

DBGET integrated database retrieval system