KEGG   Streptococcus infantarius: Sinf_1835Help
Entry
Sinf_1835         CDS       T01765                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sif  Streptococcus infantarius
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sif00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sif00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sif00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sif00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1861781..1862701
Genome map
AA seq 306 aa AA seqDB search
MNMRKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTG
KSKRSIEDHFDSNFELEYNLEHKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKA
FVGNEPFVVMLGDDLMDINNDKAVPLTKQLINDYENTHASTIAVMSVPHEEVSSYGVIAP
QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFNILETQKPGAGNEIQLTDAI
DTLNKTQRVFARQFNGDRYDVGDKFGFMKTSIDYALQHPQIKDNMKQYLIDLGKKLEAES
TKKESK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgagaaaagttagaaaagccgttattcccgcagctggtcttggaactcgtttt
ttgccagctacaaaagcactcgctaaagagatgcttccaattgttgataaaccaaccatc
caatttatcgtcgaagaagccttaaaatcaggtattgaagatatcttggttgttactggt
aaatcaaaacgttctatcgaagaccactttgactcaaacttcgaattagaatacaatttg
gaacacaaagggaaaactgatcttctcaaactcgttaatgacactacagccattaatctt
cacttcatccgtcaaagtcaccctcgtggacttggtgatgctgtccttcaagctaaagct
tttgtaggcaacgaaccattcgtcgttatgctgggtgatgaccttatggatatcaacaac
gataaagctgtaccacttacaaaacaattgattaacgactacgaaaacacacatgcatca
acaattgctgttatgtctgtgccacacgaagaagtttcatcttacggcgttatcgcacct
caaggcgaaggaaaagacggtctttacagtgttgaaacatttgttgaaaaaccagcacct
gaagatgcacctagtgatcttgctatcatcggtcgctaccttcttactccagaaatcttc
aatattcttgaaacacaaaaacctggagctggtaatgaaatccaattgacagatgctatc
gacactttgaacaaaacacaacgtgtttttgcacgtcaatttaacggtgatcgctatgat
gtcggtgataaattcggcttcatgaaaacttctattgactatgcgcttcaacacccacaa
atcaaagataacatgaaacaatatcttatcgatttgggtaaaaaattggaagctgaatca
actaaaaaagaatctaaataa

DBGET integrated database retrieval system