KEGG   Streptococcus sp. I-G2: N596_01050Help
Entry
N596_01050        CDS       T02879                                 

Definition
(GenBank) glycogen-branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sig  Streptococcus sp. I-G2
Pathway
sig00500  Starch and sucrose metabolism
sig01100  Metabolic pathways
sig01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sig00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N596_01050
Enzymes [BR:sig01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     N596_01050
Exosome [BR:sig04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N596_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM Invasin_D3
Motif
Other DBs
NCBI-GeneID: 17315446
NCBI-ProteinID: AGY39418
UniProt: U5P6U7
Position
184765..186666
Genome map
AA seq 633 aa AA seqDB search
MDTKQALYTFGTGENFHLQHYLGAHKEQVDGVEGYCFRVWAPNAQAVHLVGDFTQWEENE
IPMVRNEAGVWEVFTTAPQVGDIYKYHVTRQNGHRLMKVDPLAVRMEKRPGTGAVITDIP
ERKWKDGLWMARRRKLGFRSRPVNIYEVHAGSWKRNEDGSPYSFAQLKEDLIPYLVKMNY
THVEFMPVMAHPLGLSWGYQLMGYFALEHTYGTPEEFQDFVEACHLNNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHHRAHNYGWGAMNFDLGKNQVQSFLISSVKFWIEFYHLDG
IRVDAVSNMLYLDYDSGPWTPNIDGGNLNYEGIHFLKRMNAVIKLEHPDVIMVAEESSSG
TKITGPEEYGGLGFDYKWNMGWMNDILRFYEEDPIYRKFDFNLVTFSFMYAFSENFLLPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLLTYQICHPGKKLLFMGSEFGQFLEWRSEEQ
LEWSNLEDDMNRKMQEFTSQLNQFYKDNKMLWEIDDSYDGIEIIDADNRDQSVLTFTRKD
KKGNHLLCIFNMAPVERKDFTVGVPVAGVYEEIWNTELEKWGGVWKEHNQEVKTQEGLWK
DYPQTLTFTLPALGASVWKVKRKLRSNVSKTKE
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggatacgaaacaagcattgtacacatttggaaccggagagaactttcatcttcaacat
tatctaggggctcataaagagcaagtagatggtgtggaggggtattgtttccgcgtatgg
gctccaaatgcacaggcagtacacttagtaggtgatttcacccaatgggaagaaaatgaa
attcctatggtgagaaatgaagctggtgtttgggaagtttttacaacagcacctcaagtg
ggagatatttataagtaccatgttacaagacaaaatggccaccgcttgatgaaggtggat
cctttagcggtacgcatggaaaaacgtccaggtacaggagcggttattactgatattcca
gagcggaaatggaaagatggactgtggatggcgagacggagaaaacttggttttcgatct
cgaccagttaatatctatgaggttcatgctggatcctggaaacggaatgaagatggaagt
ccttattcctttgctcagttgaaggaagatttgattccttacttggtgaaaatgaactat
acccatgtggagttcatgccggtgatggctcacccgctcggactaagttggggctatcaa
ttgatgggttactttgccttggaacatacttacggaacaccggaagagtttcaggatttc
gttgaggcctgtcacttgaataacattggggtgattgtggactgggtgcccggacacttt
acgatcaatgatgatgccttggcctattatgatgggacaccaacctttgaatatcaggac
catcatcgggctcacaactatggttggggagcaatgaactttgacctagggaaaaaccag
gtccaatccttccttatttctagtgtaaaattctggattgagttttatcatttggatgga
atccgggtcgatgcggtcagcaacatgctctacttagattacgatagtggtccatggaca
ccaaatatcgatggtggaaatctcaattatgaggggattcatttccttaaacgaatgaat
gcggtgattaaacttgagcatcctgatgtgatcatggttgctgaagaaagttcatctgga
actaagattactggtccagaagaatacggtggcttaggttttgactacaagtggaatatg
ggatggatgaatgatatccttcgcttctacgaggaagatcctatttaccggaaatttgat
ttcaatttggtgacctttagctttatgtatgctttctctgagaatttcttgttgccgttt
tctcacgatgaagtggtgcatggcaagaagagtctcatgcataagatgtggggagatcgc
tacaatcagttcgccggcttgagaaatctcttgacctatcagatttgtcacccagggaag
aaattgctcttcatgggttcagagtttggccaattcttagagtggaggtctgaagaacag
ttagaatggtctaatctggaagatgacatgaaccgcaagatgcaagaatttacttcccag
ctcaatcaattctacaaagacaacaagatgttgtgggaaattgatgatagctatgatggt
attgagattattgatgcagataaccgagatcaaagcgttttgacctttactcgtaaggat
aaaaaaggaaatcatttgctttgtatctttaatatggcaccagtagagcgcaaggacttt
acagtcggcgtccctgtagctggggtctatgaagaaatttggaatacagaattagagaaa
tggggaggtgtctggaaagagcacaaccaagaagtgaagactcaagagggattatggaaa
gattatccacaaaccttaacctttactttaccggctcttggagctagtgtatggaaagtg
aaacgaaaacttcgttccaatgtgtctaaaacaaaagaatag

DBGET integrated database retrieval system