KEGG   Streptococcus sp. I-G2: N596_03925Help
Entry
N596_03925        CDS       T02879                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sig  Streptococcus sp. I-G2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sig00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N596_03925
Enzymes [BR:sig01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     N596_03925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
771555..773006
Genome map
AA seq 483 aa AA seqDB search
MENQTLMQYFEWYLPSDGQHWSRLAADAPHLADLGIRKIWMPPAFKATSANDVGYGVYDL
FDLGEFDQKGTVRTKYGFKEDYLQAIQALKEAGIQPMADVVLNHKAAADGLEKFEVVEVD
PNDRTIVLTEPFTIKGWTKFTFDGRNGAYNDFHWHWYHFTGTDYDASRNKSGIYQIQGDN
KGWAQDDLVDSENGNYDYLMYADIDFKHPEVIENLNQWAEWFIETTGVEGFRLDAVKHID
SFFMKNFIQQITDKYGEDFYVFGEFWNGDEQSNNDYLASIAYKFDLVDVALHQNLFRASQ
EGENFDLTTIFNGTLASNHPESAVTFVDNHDTQRGQALESTVGEWFKPAAYALILLREAG
LPCVFYGDYYGISGEFAQQDFQAELDQLLRIRKDLAYGEQRDYFDDPNCIGWTRSGTEET
APIACVISNAGPSAKRMEIGQAYAGRTYYDALGNYQDTIQIEEDGWADFPVSDRSVSVWI
LAD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaaccttaatgcaatattttgaatggtacttaccttcggatggtcaacac
tggtcccgcttagctgcagatgctcctcacctagcagatttgggtattcgtaaaatttgg
atgcctcctgcttttaaagccacttctgccaatgatgtcggctacggcgtctatgacctc
tttgaccttggagaattcgaccaaaaagggactgttcggaccaaatatggtttcaaagaa
gactacttgcaagccatccaagccttaaaagaagctggaatccagcccatggccgatgtc
gttctcaaccataaagcagctgccgatggtttagaaaaattcgaagtggtcgaagtggac
cctaacgatcggaccatcgtcttgacagagccttttacgattaaaggttggacaaaattt
acctttgatggtcgaaatggagcctacaatgacttccactggcattggtaccactttacc
ggtaccgactacgatgcttcccgcaataagagtgggatttaccagattcaaggagacaac
aaaggttgggcacaagacgacctcgttgatagtgagaacggaaactacgattacctcatg
tacgccgatatcgactttaaacaccccgaagtgatcgaaaacctcaatcaatgggcagaa
tggtttattgaaaccactggggttgaaggcttccgtctagacgctgttaaacacatcgac
tccttcttcatgaagaacttcatccaacaaattacggacaaatatggagaagatttctat
gtatttggtgagttttggaatggggatgaacaaagcaacaatgactacctggccagcatt
gcctacaagtttgacttagtggacgttgccctccaccaaaatctctttagagctagccaa
gaaggggaaaactttgacttaacgactattttcaatggtactcttgcaagcaatcatcca
gaaagtgcggtaacctttgtcgataatcacgatacccaaagaggacaagctctagagtcc
acagttggtgaatggttcaagcctgctgcttacgccctcattctcctccgcgaggccgga
cttccatgtgtcttttatggagactactacgggatttcaggtgagtttgcccagcaagat
ttccaagcggagcttgatcaactccttcgtatccgcaaagacttagcctacggtgaacaa
agagactactttgacgatcctaactgtattggttggacgcggtctggaactgaagagact
gctcctatcgcctgcgtcatttcaaatgctggtccatccgccaaacggatggaaattggt
caagcctatgcaggacggacctactacgacgctttaggaaattaccaagataccatccaa
attgaagaagacggttgggctgatttcccagtctcagaccgctccgtcagcgtgtggatt
ttggcagactaa

DBGET integrated database retrieval system