KEGG   Streptococcus sp. I-G2: N596_04285Help
Entry
N596_04285        CDS       T02879                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sig  Streptococcus sp. I-G2
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sig00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    N596_04285
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    N596_04285
  Energy metabolism
   00680 Methane metabolism
    N596_04285
Enzymes [BR:sig01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     N596_04285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(854752..857577)
Genome map
AA seq 941 aa AA seqDB search
MTLQKLESYTNKEIIKEEVEILTTILEDIAKNLVSPETFDKILELKKLSVSKDYLKLDQI
VRELSNEEMIVISRYFAILPLLINISEDVDLAFEINHQNNVGQDYLGKLSSTIRQVAETE
NAQEILERLNVVPVLTAHPTQVQRKTMLDLTTQIHSLLRQHRDVKAGLMNETKWYNNLRR
NIEIMMQTDMIREKKLKVTNEITNVMEYYNSSFLQAVPNLMLEYKRLAKEQGIELQQPKP
ITMGMWIGGDRDGNPFVTAETLKRSATIQSEVILNYYIQKISSLYRNFSLSTNLSKTSQA
VEEMAARSSDTSVFREKEPYRRAFHYIQSKLVQTLLNIKEWSVVGSTVDERHPIERLLGA
HTHQQGVVSDYIGTRISGAIQELAEDRPPYYETVEEFKQDLTLIQESLIENKAEALISGE
FAELLEAVEVFGFFLASIDMRQDSSVHEACVAELLKEAGINDHYSDLSEDEKCELLLQEL
LEDPRILSATHAEKSELLEKELAIFQTARELKDRLGEDVIRQTIISHATSVSDMLELAIM
LKEVGLIDKESARVQIVPLFETIEDLDQSEDTMRKYLSLPIAKRWIASKNNYQEIMLGYS
DSNKDGGYLSSCWTLYKAQQQLTAIGDEFGVKITFFHGRGGTVGRGGGPTYEAITSQPLR
SINDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSATINRMIAKKKSEKSMSDQYNEIMDQ
IVNRSYDIYRELVFGNEHFYDYFFESSPIKAISSFNIGSRPAARKTIKEIGGLRAIPWVF
SWSQSRVMFPGWYGVGSSFKEFIDADPENIETLRYMYQKWPFFKSLLSNVDMVLSKANMN
IAFEYAKLCEEEEVRDIFNIILDEWQLTKDVILQIEGHDELLAENPYLKDSLDYRMPYFN
VLNYIQLELIKRQRRGELPADQDKLIHITINGVATGLRNSG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgactttacaaaaactagagagctataccaacaaagagattatcaaagaagaagttgag
attttaaccactattttagaagacattgctaaaaatttggtgagtccagaaacctttgat
aagattcttgaattgaaaaaactatctgtctcaaaagactatttaaaattggatcaaatt
gttagagagctatcaaatgaagagatgatcgtgatttctcgatactttgccattctcccc
ttattgattaatatctctgaagatgtcgatttggcttttgaaatcaatcatcagaataat
gtgggacaggactatctaggaaaactatcgtcaaccatccgccaggtggctgagactgaa
aatgctcaggaaattttggaacgcctcaacgtggtaccagtattgacagctcatcctacc
caagtgcaacggaaaaccatgttggacctaaccactcagattcacagccttttgcgccaa
catcgggatgtgaaagcaggcttgatgaacgagaccaaatggtacaataatttgcgtcga
aacattgaaattatgatgcaaaccgatatgatccgtgaaaagaaactcaaggtaacaaat
gagattaccaatgtcatggaatactataatagttccttccttcaggctgttcctaactta
atgttggaatacaaacgtcttgccaaggagcaagggatcgagttacagcaacctaaaccg
attacgatgggaatgtggattggtggagaccgggatgggaatccttttgtaactgctgag
accttgaagcgatcagctaccattcaaagtgaagttattctaaactactatattcagaaa
atatctagcctatatcggaatttctccctttctaccaatctttcaaaaaccagtcaagcg
gttgaagagatggcggcccgttcgagtgatacctctgtctttagagagaaggaaccctac
cgtcgagccttccattatattcaatccaaattggtccaaaccttattgaatattaaggaa
tggtcagtagttggctcaacagtagatgagcgccatccgattgaacgtcttctcggtgct
cacacccatcaacaaggagtggtttccgattatatcggtacccgtatcagtggtgctatc
caagagttggcagaagatcgtcctccttattacgaaacagttgaagaatttaaacaggat
ttgaccctgattcaagaatcattgattgaaaataaggcagaggctttaatctcaggtgag
tttgctgagttattagaagcagtagaggtctttggtttcttcttggcttcgattgacatg
cgtcaagattcgagtgttcatgaagcctgtgtggcagaactattaaaagaagcagggatt
aatgatcactacagtgatttgtcagaagacgaaaagtgcgagttgctgttacaagagttg
ttagaagatcctcggattttatctgctacccatgcagaaaaatcagaattgcttgagaaa
gaattagctattttccaaacagcgcgtgaattaaaagaccgcttaggagaagatgtcatt
cgtcaaaccattatttctcatgcaaccagtgtatcggatatgcttgagttggccatcatg
ttgaaagaagtgggactgattgacaaggaaagcgcacgtgtgcaaattgttcctctcttt
gagacgatcgaagacttggaccaatctgaagatacgatgagaaagtatctgtcacttcca
attgctaaacgctggattgcttctaagaacaactaccaagaaattatgcttggatactca
gatagtaataaagacggtggttatctatcttcttgttggactctttataaggcccaacaa
caattaacagcgattggcgacgaatttggtgtcaagatcaccttcttccatggccgtggt
ggaacggttggtcgtggtggtggcccaacctatgaagctatcacctcacaaccattgaga
tccatcaatgatcgaattcgtttgactgagcaaggtgaggtcattggcaacaaatatggg
aataaggatgcagcttattacaacttagaaatgttggtctctgcaacgattaaccggatg
attgctaagaagaagagtgaaaagagcatgtccgaccagtacaatgagattatggatcag
attgtcaatcgtagctacgatatttatcgtgaactggtttttggcaatgaacatttctat
gattacttcttcgaatccagtccaattaaggccatttctagtttcaatattggttcgcgt
ccagcagcccgtaagaccatcaaagaaatcggtggcttgcgtgccattccttgggtcttc
tcatggtcacagagccgcgtgatgttccctggctggtacggtgtagggtccagttttaaa
gaatttattgatgcagaccctgaaaacattgaaaccttgcgttatatgtaccaaaaatgg
ccattcttcaagtctcttctttcaaacgtagatatggtgctctcaaaagccaatatgaac
atcgcatttgaatatgccaagctgtgtgaagaagaggaagttcgtgatatcttcaatatt
atcctggatgaatggcaactgaccaaggatgttattttacaaattgaagggcatgatgaa
ctcttagctgagaacccttatctaaaagatagtttagattatcgtatgccatactttaat
gttctgaactatatccaattagaattaattaaacgccaaagacgtggtgaattgcctgca
gatcaggacaagttgattcatatcacaatcaatggtgtcgcgacaggattgcgtaattct
ggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system