KEGG   Sulfolobus islandicus HVE10/4: SiH_0244Help
Entry
SiH_0244          CDS       T01952                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SiH_0244
Enzymes [BR:sih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SiH_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(205996..206847)
Genome map
AA seq 283 aa AA seqDB search
MIHLAVGRFNIDIIVKLDSIPPIDSSHMTDVLEIMPGGAATNYAVAVTKLGHSAKLLAKV
GKSEVVRSLMEKVVELGVGLEYVEELNEKPSATLIFLRSDGTLSMVRRLGASILLTREDV
KRRFGLFDVIHFASVSPNVVVRDPYAKLVSYDPGPQAKNIESIDVDILYINEKEYEMIEG
KNIKARFIVIKMGKKGAKIITETEECSVEPIQVEKVVDTTGAGDTFDAAFNVTYSEEKDI
IKSLQVASVASGLKVTKIGGISSPTLEEVREYLRKKKPNVICK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgatacacctagcagtggggagatttaacattgatattatagtaaaattggattctatt
ccacctatagattccagtcatatgacggatgttcttgaaatcatgcccggaggagctgca
acaaactatgcagtggcagtgactaaactgggtcactctgctaaactattagcaaaggtt
gggaaaagcgaagtagttagaagtctaatggaaaaagtagtagaattaggggtaggatta
gaatacgtagaggaattaaacgagaaacctagtgcaacactaatcttcttgagaagtgat
ggaacactatctatggtaagaagacttggcgcatcaatattgctaacaagagaagatgta
aaaaggcgttttggactgtttgacgttattcacttcgcctcagtatcaccaaacgttgtt
gtgagagatccttatgcaaaattagtaagctatgatcctggcccacaagctaaaaatata
gagtcgattgacgtagacatcttatatattaatgaaaaagagtatgaaatgatagaaggt
aagaacataaaggccagatttatcgtcattaagatgggcaagaaaggggcaaagataatt
actgagactgaagagtgttcagttgaaccaatacaagtagaaaaggtagttgatactact
ggagctggagatacctttgatgcagcatttaatgtaacatattctgaggaaaaggatatt
ataaagagtctacaagttgctagcgttgcatctggtcttaaggttacgaagataggagga
atttcttcaccaacattagaagaggtaagagagtatttaaggaaaaagaaaccaaatgtt
atatgtaaatga

DBGET integrated database retrieval system