KEGG   Sulfolobus islandicus HVE10/4: SiH_0345Help
Entry
SiH_0345          CDS       T01952                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
sih00010  Glycolysis / Gluconeogenesis
sih00020  Citrate cycle (TCA cycle)
sih00620  Pyruvate metabolism
sih00633  Nitrotoluene degradation
sih00640  Propanoate metabolism
sih00650  Butanoate metabolism
sih00680  Methane metabolism
sih00720  Carbon fixation pathways in prokaryotes
sih01100  Metabolic pathways
sih01120  Microbial metabolism in diverse environments
sih01130  Biosynthesis of antibiotics
sih01200  Carbon metabolism
Module
sih_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiH_0345
   00020 Citrate cycle (TCA cycle)
    SiH_0345
   00620 Pyruvate metabolism
    SiH_0345
   00640 Propanoate metabolism
    SiH_0345
   00650 Butanoate metabolism
    SiH_0345
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiH_0345
   00680 Methane metabolism
    SiH_0345
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SiH_0345
Enzymes [BR:sih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SiH_0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N CoA_binding_3
Motif
Other DBs
NCBI-ProteinID: ADX81716
UniProt: F0NJC5
Position
complement(295052..296068)
Genome map
AA seq 338 aa AA seqDB search
MVEKEMEEKVYKSIIKTIKDTPLEEFYTSGHRTCQGCESALVMRFLAKAAGQRTIVIGAT
GCMYVANTTYYSTSWIVPWVHTQLGGSGAAALGTAAALRALMRKGKIKQEPINVIAFCGD
LGCADMGLSGVSNAMTYDYNLLIVLYDNESSANTDIQETSMTPYGAQTSFSRPGKQRRIM
KKRWKKSVVPMIIAGHRNIRYAATMTPAYPLDSINKIKKALAIGGPTFIHSLDPCPKGWD
YDPRFSHELGVLAAETGLWPLYEYTDGEIAYNEPTKSIVEGRMKRKPVKEYLEKQGRFSH
FTEEDIEHIQRMVDEMYEEWEIPGVMPIKSLNVKISDK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaaggaaatggaagaaaaggtgtataagtcaattattaagacaataaaagat
acaccactggaagagttctatacatctggccataggacttgtcaaggatgtgagtcagca
ctagtcatgaggtttttggctaaagctgccggacaaaggaccatagttataggagctact
ggatgcatgtatgtggcaaatactacatattatagcacgtcatggatagtaccatgggtt
cacacgcaattgggaggatctggtgcagctgcattaggtacagccgcagcattgagagca
ttaatgaggaaaggaaaaataaagcaagaacctataaacgtgatagccttctgtggagat
ctaggatgtgcagatatgggtttgtctggagtttcaaacgcaatgacgtatgactataac
ttactcatagtactttatgataatgaatcttcagctaacactgatattcaagagactagc
atgacaccttatggagcacagacctcattcagtaggccaggtaagcaaagaaggataatg
aagaagaggtggaagaagagtgtagttccaatgataatagcagggcataggaacattaga
tacgccgctaccatgacccccgcctatccactggattcaataaacaagatcaagaaggca
ttagcaataggaggcccaactttcattcattccttagatccatgtccaaagggatgggat
tacgatccaaggttctctcatgaactgggagtattggcagctgaaactggactgtggcca
ctatatgagtatactgatggggagatagcgtacaatgagcccacaaagagtatagtggag
ggtagaatgaagagaaaaccggtaaaagagtacttagaaaagcaaggaagattctcacac
tttacagaggaagacatcgagcacatacaaaggatggttgacgagatgtatgaagaatgg
gaaatccccggagtaatgccaataaagtcgttaaatgtaaagataagtgacaaataa

DBGET integrated database retrieval system