KEGG   Sulfolobus islandicus HVE10/4: SiH_0374Help
Entry
SiH_0374          CDS       T01952                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
sih00010  Glycolysis / Gluconeogenesis
sih00020  Citrate cycle (TCA cycle)
sih00620  Pyruvate metabolism
sih00633  Nitrotoluene degradation
sih00640  Propanoate metabolism
sih00650  Butanoate metabolism
sih00680  Methane metabolism
sih00720  Carbon fixation pathways in prokaryotes
sih01100  Metabolic pathways
sih01120  Microbial metabolism in diverse environments
sih01130  Biosynthesis of antibiotics
sih01200  Carbon metabolism
Module
sih_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiH_0374
   00020 Citrate cycle (TCA cycle)
    SiH_0374
   00620 Pyruvate metabolism
    SiH_0374
   00640 Propanoate metabolism
    SiH_0374
   00650 Butanoate metabolism
    SiH_0374
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiH_0374
   00680 Methane metabolism
    SiH_0374
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SiH_0374
Enzymes [BR:sih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SiH_0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_7 Fer4_21 Fer4_2 Fer4_10 Fer4_16 Fer4_9 Fer4_4 Fer4_8 Fer4_15 Fer4_17 Fer4_3 Fer4_13 Fer4_22 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ADX81744
UniProt: F0NN61
Position
complement(325657..325923)
Genome map
AA seq 88 aa AA seqDB search
MIKIPMGVPVARPRIGSAGKTGLWRVEKPVVDYNKCTKCRLCVIYCPENTINLLENLYPQ
IDYDYCKGCGVCAQVCPPKAIDMVREVK
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaaatccccatgggagtaccagtagctaggccaaggataggatctgcgggaaaa
actggattatggagagttgagaaaccagtagttgattacaataagtgtactaagtgtaga
ctttgcgtaatttattgcccagaaaatactattaatctcctagagaacctctatcctcaa
attgattacgattattgtaaaggttgtggtgtttgcgcacaagtttgcccacctaaggca
atagatatggttagggaggtgaagtga

DBGET integrated database retrieval system