KEGG   Sulfolobus islandicus HVE10/4: SiH_0476Help
Entry
SiH_0476          CDS       T01952                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SiH_0476
   00052 Galactose metabolism
    SiH_0476
   00500 Starch and sucrose metabolism
    SiH_0476
   00520 Amino sugar and nucleotide sugar metabolism
    SiH_0476
Enzymes [BR:sih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SiH_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438240..438992
Genome map
AA seq 250 aa AA seqDB search
MHAVITAAGLGTRMLPASKEIPKEMFPIPFNNGFKPIIQIIFEQLYNKGIRDFVIVVGRG
KRVIEDHFTPDYDFVSYLEKVGKEKQARELLTFYSKIEKSNIAFVNQPEPKGFGDAVLRV
EPFINDKFIVVAADTLLREIPDLIPNSFLVTEVEDPRPYGVVILEGDRVIDVEEKPKNPK
SRFIIVPYYMFTYDIFHALREVKCNGELQLTEGIKILLKKGVEFIAKRVNDVYDLGSIEN
YIASIKKIIG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcagtaataactgcagctggattaggcactcgaatgttacccgcttctaaagaa
attcctaaggagatgtttccaattccctttaacaatggatttaagccaattatacaaata
atctttgagcaactttataacaagggtataagggatttcgttatagttgttggtaggggt
aagagggtaattgaagatcattttacaccagattacgattttgtctcttaccttgaaaaa
gtaggtaaagaaaagcaggcaagggagttattaacattttactctaaaatagagaaaagc
aatatagcatttgtaaatcagcctgaaccaaaaggatttggagatgcggtactgagagta
gaaccttttattaatgataaattcattgtagtagcagcagacactctattaagagagatt
ccagatttaatacctaactcttttctagttactgaagtagaagatcctagaccatatggt
gtagtaatattagagggagatagagttatagatgtcgaggaaaaacctaagaatcctaaa
tcccgttttataatagttccttactatatgtttacatatgatatatttcacgccttaaga
gaagttaagtgtaacggagaattacaacttactgaagggataaaaatattgctcaaaaaa
ggtgtggaatttattgcaaaaagagtaaatgatgtttatgatctgggtagtatagagaat
tatattgcatctataaagaaaattattggataa

DBGET integrated database retrieval system