KEGG   Sulfolobus islandicus HVE10/4: SiH_0511Help
Entry
SiH_0511          CDS       T01952                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SiH_0511
  Amino acid metabolism
   00300 Lysine biosynthesis
    SiH_0511
Enzymes [BR:sih01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SiH_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(481868..482992)
Genome map
AA seq 374 aa AA seqDB search
MENVIKILSELVSFETYNPPGKDYDKIAYYLRDLFESIGFSVELIEIPEEYLDRNYIYSP
RHKGNKRIIVLAKNNEEPLIHFNAHYDVVPAGNGWLTDPYKLKLVGDKAYGRGVSDMKGG
IVSMYLALSETKRPVEISLVPDEESGGIGTKYLTEVRKIRAKYVIIGEPSFPDIYIGHLG
IIRGVIRVIGKQVHASKAKEGENAFIKAAKLALEIQKIYNVKEVSLNLGGYMINSSDNDG
VVPGEFAFSFYRSTLPDEKNVEDEIRSIVSKAANNVNVKYEMEVKSYVPGSLTPKDSKLV
KVAEECVYRVINVLPEKIIAQIRYDGVFFRPFAEVINIGPGDNAHIPNESVSVSNIGKTS
RIYGCIISTLFLRD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtaattaagatattatcggaattggtatcttttgaaacttataaccctccg
ggaaaagattatgataaaatagcttactatctaagggatctatttgaaagtataggtttt
tctgttgagttaattgaaatacccgaggaatatttagatagaaattatatttattctcca
agacataaaggaaataaaaggataatagttttagctaaaaataatgaagagcctttaatt
cacttcaacgctcattacgatgttgtgcccgcaggtaacggatggttaacagatccctat
aaactgaaattggtaggcgataaggcttatgggagaggagtatcggacatgaagggagga
atagttagtatgtatttagccttaagtgaaactaaaagaccggtggaaatttcattggtc
ccagatgaggagagcgggggtataggtactaaatatttaactgaagtgaggaaaataagg
gccaaatacgtaatcataggtgagcctagcttccctgatatatacatagggcatttggga
ataataaggggtgttattagggttattgggaaacaagttcacgcaagtaaggctaaagaa
ggagaaaacgctttcataaaagcagccaaattagctttagaaatacagaaaatttacaat
gttaaagaagtatcattaaatctaggcggatatatgatcaactcttcagataatgatggc
gtagttccaggagaattcgctttcagtttctacagaagtactttaccagatgagaaaaac
gtcgaggatgaaatcagaagtatagtaagtaaggctgcaaataacgtaaatgtcaaatac
gaaatggaggttaagtcttatgttcctggatcacttacccccaaggattctaagttagta
aaagtagcggaggaatgtgtatatagggttataaacgtattaccggagaagataatagca
caaatcagatatgatggtgttttcttcagacctttcgctgaggtcataaatataggaccc
ggggataacgcacacatacctaacgagagtgtaagtgtaagtaacataggtaaaactagt
aggatatatggttgtattatctctacgttatttctaagggattaa

DBGET integrated database retrieval system