KEGG   Sulfolobus islandicus HVE10/4: SiH_0576Help
Entry
SiH_0576          CDS       T01952                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
sih00010  Glycolysis / Gluconeogenesis
sih00620  Pyruvate metabolism
sih00640  Propanoate metabolism
sih00680  Methane metabolism
sih00720  Carbon fixation pathways in prokaryotes
sih01100  Metabolic pathways
sih01110  Biosynthesis of secondary metabolites
sih01120  Microbial metabolism in diverse environments
sih01130  Biosynthesis of antibiotics
sih01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiH_0576
   00620 Pyruvate metabolism
    SiH_0576
   00640 Propanoate metabolism
    SiH_0576
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiH_0576
   00680 Methane metabolism
    SiH_0576
Enzymes [BR:sih01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SiH_0576
Lipid biosynthesis proteins [BR:sih01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SiH_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADX81936
UniProt: F0NNH8
Position
559589..561118
Genome map
AA seq 509 aa AA seqDB search
MKYQELKKEFSWSEALSYFKDNLLSFPKNSSTALVRFDMSYDKISYSFYELYNKSSRLAG
FMEGLGVKKGNVISVLASKKAEQPIILLATWMIGAIYQPLFTAFGPLAIEIRTRDVKPKI
IFSQEDQIQKLERFNSTIITFPGKTSNSLSFDDAISSEPIKNPNRPSLDDTAILIYTSGT
TGKPKGALVSFRLLLNTYVYMKYGIGLQGDDFFWNPADPGWAYGLYYGLIGPLLFGKTVF
FLDKPFDPEDTLKFLEDNKITNLAFAPTAYRIIAGKIRDPKKYNLKIRRASSAGEPLNPE
IIKWFNTNYGITIKDHYGQSEVGMVVYNGWGYEAETKPGSMGLPAPGYEITTIDEVIAVN
SKSEGFCFKGYLADEERTKNSFKGDWYLTGDMAKIDDQGYFWFVGRQDDVVKVSGYRVGP
FEIESVLITHPSVLETAVVPVDDPVRGHVFKAFVVLKQGYSPSDELAKELLDLVRQNYSK
HVHLHEIKFVDSLPKTESGKIQRFKLRNM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcaagagcttaaaaaggaattctcttggagcgaagcattaagctattttaag
gataacttgctttcatttccaaaaaattcaagtactgcgttggtaagatttgacatgagt
tatgataagatatcgtattcattttatgaactttataataaaagtagtagacttgcaggt
tttatggaaggattgggcgttaaaaaaggaaatgttatatcagttttagcctctaaaaaa
gctgaacagccaataatacttttagctacatggatgataggagcaatttatcaaccactt
ttcacagcgtttggaccattagctatagaaattaggacaagggatgttaaacctaaaatt
atattctcacaagaagatcaaattcaaaaactcgaaagatttaattcaaccataataacg
tttcctggtaaaacttctaattcattaagttttgatgatgcaatatcatccgaaccaata
aaaaatcctaataggccttctctcgacgatactgctattttaatatacacttcaggaact
actggtaaacctaagggtgcattagttagttttcgattgctactaaatacttacgtatat
atgaaatatggtataggattacaaggagacgactttttctggaatcctgcagacccaggc
tgggcatacgggttatattatggtttaataggtcctttacttttcggtaagacagtattt
ttcttagacaaaccttttgatccagaagatacattaaaatttttagaagataataaaatt
actaacttggcatttgcccctactgcatacaggataatagctggaaaaattagagatcct
aaaaaatataacttgaaaataaggagagcaagttcagcaggagagccccttaatccagaa
ataataaaatggtttaatacaaattatggaattactataaaggatcattacggtcagtct
gaagtaggaatggtagtttataatggatggggatatgaagcagaaacaaaacctggaagt
atgggattgccagctccaggctatgaaattacgactattgatgaagtaatagcagtcaac
tctaagagtgaagggttctgttttaaaggttatctagctgacgaagaaagaactaaaaac
tctttcaagggagattggtatttaactggggatatggctaaaattgatgatcaaggatat
ttctggtttgtaggaaggcaagacgacgtagttaaagtttcaggatatagagtaggtccg
tttgaaatagaaagtgtattaataactcatccctcagttttagaaacagcagtagttccc
gtagatgatccagtaagagggcatgtatttaaagcatttgtagtacttaaacaaggatat
tctccaagtgacgaactagctaaagagttgcttgatttagttagacaaaactactctaag
cacgttcatctacatgaaataaaattcgtagattccttacctaagacagaaagcggaaaa
attcagagatttaaattaaggaatatgtaa

DBGET integrated database retrieval system