KEGG   Sulfolobus islandicus HVE10/4: SiH_0614Help
Entry
SiH_0614          CDS       T01952                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SiH_0614
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiH_0614
   00620 Pyruvate metabolism
    SiH_0614
   00640 Propanoate metabolism
    SiH_0614
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiH_0614
   00680 Methane metabolism
    SiH_0614
Enzymes [BR:sih01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SiH_0614
Lipid biosynthesis proteins [BR:sih01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SiH_0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(598335..600158)
Genome map
AA seq 607 aa AA seqDB search
MVFNPDKEWIENSNVYKFMVEKNLDKLEDFIKYTYENPEFWDEFVKLINVKFPEPYTKVL
DLSRGKQWPQWFIGGKLNIGDQLRDSSDVFIKWMDESFNTRMVTYSQILNESKSIASWLK
RIGLKKGDRVAIYMPMIPEIVSVMLGAVRAGMILVPLFSGFGPEPIRVRIEDSEAKVIFT
VDKSIRRGKEVGMLRNLEGLNIAKVVLNRGGTKGDFYDYKDVIRTSGDYVENTGTEDPMM
IIYTSGTTGKPKGCVHTHDGFPIKASADIYFQFDLKKDETLMWVTDMGWMMGPWMVFGSL
LLDAKMGMIEGYTGGEVLQKFIEDMKVDVLGVSASLVRALRSQGEVKLNVRLTGNTGEPI
DPESWYWLFNASGKNPIINYSGGTEISGGILGNYVIKKIKPSSFNGPSPGINASVFNEEG
KEAPPNVEGELVILSVWPGMTRGFWRNPERYIETYWSIWKDIWVHGDLAYRDEEGYFYIV
GRSDDTIKVAGKRVGPAEIESVLNSFPNVVESACVGVPDPMKGEKIVCFVVSKVGDIEKD
LIRYTEDKLGKVFAPSEIKIVKELPKTRNAKIMRRLIRAVYLNKPLGDISSLENPSALEE
IKRALIS
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggtatttaatccagataaggaatggatagagaatagcaatgtatacaagttcatggtt
gaaaagaacctcgataaactagaagacttcattaaatatacgtacgagaatccagaattt
tgggatgagtttgtaaagttaataaacgtgaaatttccagaaccttatactaaggttcta
gatctaagtaggggaaagcaatggcctcaatggttcatagggggaaagttaaacattggt
gaccaattacgcgatagttctgatgtgtttattaagtggatggatgagagcttcaacact
agaatggtaacctattctcaaatactaaatgagagcaagtcaattgcaagttggttaaag
agaataggtttaaagaaaggagatagggttgccatttacatgccaatgatcccggaaata
gtatcggtaatgttaggtgcagttagagcagggatgatactcgtacctctattttctggg
tttggcccagagccaataagagttagaatagaggatagtgaggctaaagtaatcttcacg
gtcgataagagcattagaaggggaaaagaagttggtatgttgagaaatctggaaggacta
aatatagctaaagtagtattgaataggggaggtactaagggtgatttttatgactataag
gatgtaataagaactagtggagactatgtagaaaatactggtactgaagacccaatgatg
ataatttacacttctggaactactggaaaacccaaaggatgtgttcatactcacgatgga
tttccaataaaggcatctgctgacatttactttcagttcgatctgaaaaaagatgagacc
ttaatgtgggttaccgacatggggtggatgatgggaccgtggatggtatttggatcactc
ttactagatgctaaaatggggatgattgaagggtatacgggtggggaagtcctacagaaa
ttcattgaagatatgaaggttgatgttttaggagtctcagctagtcttgttagagcgtta
agaagtcaaggtgaagttaaactaaacgttaggctaacaggaaatactggagaaccaatt
gatccggaaagctggtattggttatttaacgctagtggaaagaaccccattataaactat
tctggaggtactgaaatctctggaggtattttagggaattacgttataaagaaaataaag
ccatcttcatttaatggtccctccccgggaattaatgcttcagtatttaatgaggaagga
aaagaagctccaccaaatgttgagggggaattggttatattgagtgtctggccaggtatg
accaggggattttggaggaatcccgagaggtatattgagacttattggtcaatttggaaa
gatatatgggttcacggagatttggcttatagagatgaagaagggtatttttatattgtt
ggaagaagtgatgatacgataaaggtcgctggaaagagagtaggtccagccgaaattgaa
agtgtgttaaattcctttccaaatgtagttgaatcagcatgtgttggagttccagatcca
atgaagggagagaaaatagtctgtttcgtagtctcaaaggttggcgatattgaaaaggac
ttgataagatatacagaggataaactgggtaaagtatttgcaccatcagaaataaagatc
gttaaggagttacctaaaactagaaatgcaaaaataatgagaagactgataagggcagta
tacttaaataaacccttaggggatatctcctcactagaaaatccatcagctttagaggaa
ataaagagggccttgattagctga

DBGET integrated database retrieval system