KEGG   Sulfolobus islandicus HVE10/4: SiH_0646Help
Entry
SiH_0646          CDS       T01952                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SiH_0646
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiH_0646
   00620 Pyruvate metabolism
    SiH_0646
   00640 Propanoate metabolism
    SiH_0646
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiH_0646
   00680 Methane metabolism
    SiH_0646
Enzymes [BR:sih01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SiH_0646
Lipid biosynthesis proteins [BR:sih01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SiH_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(633291..634787)
Genome map
AA seq 498 aa AA seqDB search
MASYEEVRRSFSWIEVIRYLDKNTLDVLTSHDGIAVKRVTKNAVEKISFSDLKRKALRLA
LYLKEFHNVKKGDVIAVLASKKIQQVIILLATLSLGAIYQPLFTAFGPEAIRMRTGDVKP
KVIFCQDDQKDKVNNAISFSKFDELLSYGELKEIEKINWDDAIILLYTSGTTGTPKGALI
AKRLLLNTYVYMKYGIGIRENDVFWNPADPGWAYGLYYGIIGPLMFGKTIIFLDEPFNPE
RTMEFMEENKVTNFAFAPTAYRMIAGTVKKKYDLVLERASSAGEPLNPEVIRWFMDKYSV
TIKDHYGQTEVGMVVYNGWGYDAKVKIGSMGLPAPGYEVDIIEDIIGVKRDSPGFHFLGY
LNNPEKTKESFRGDWYLTGDNAYRDEEGYLWFVGRKDDVVKVSGYRIGPFEVESVLLEFP
AVLESAVVADEDPIRGHVLHAYIVLKSGYTPSEELKKEIIDFVNTKYSRHVHLERVDFVD
KLPKTESGKIQRYLLRKK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctagttatgaagaagttaggagaagtttttcgtggattgaagtaattagatattta
gataagaacacattagacgttttgacttctcatgacggtatagcagttaagagagtcact
aagaacgctgtggagaagataagcttctcagatcttaaaagaaaagcgttaagacttgcc
ttatatctcaaggaatttcataatgttaaaaagggtgatgtaatagcagtattagcttca
aagaagattcaacaagtcataatacttttagcaactctctccctaggagcaatttatcaa
ccattatttactgcatttgggccagaggcaattaggatgagaactggggatgtaaaacca
aaagttatcttttgtcaagacgatcaaaaggataaggtaaataatgcaatatccttctcc
aagttcgatgaattattaagttacggtgaattgaaagagattgaaaaaataaattgggat
gatgcgataattttactttacacttctggtactacgggaacacctaaaggggctctaatc
gctaagaggctacttcttaacacttatgtctacatgaaatatggtataggtattagggaa
aatgacgtgttttggaaccccgcagatcccggatgggcttatgggttatattatggtata
ataggaccactaatgtttggaaaaactataatcttccttgacgaaccatttaacccagaa
aggacaatggagttcatggaggaaaataaggttactaattttgctttcgcacctacggca
tatagaatgatagctggaacggttaagaagaagtatgatttagtattggaaagagctagt
tctgcaggtgaaccacttaacccagaagttataagatggtttatggataagtacagtgtt
actatcaaagatcattatggacaaactgaagttggaatggtagtttataacggctgggga
tatgacgcaaaagtaaaaatagggagtatgggactacctgcacctggttatgaggtcgat
ataatagaggatattataggtgtcaagagagattctccaggtttccacttcttgggatat
ctaaacaatccagagaagaccaaggaatcatttcgaggcgattggtacttgactggtgat
aatgcgtatagagatgaggaaggatatttatggtttgttggaaggaaggacgatgtggtt
aaggtatctggttacaggataggtccatttgaagttgagagcgtacttctagaatttccc
gcagtactagaatctgctgttgttgccgatgaagatccaatacgaggacatgtattacat
gcttatattgtactcaaaagtggatatactccaagtgaggaactaaagaaggagattatt
gattttgtaaatactaaatattctagacacgtacatctagaaagggttgactttgttgat
aaattaccaaagactgagagtggcaaaatacaaaggtatctacttagaaagaagtga

DBGET integrated database retrieval system