KEGG   Sulfolobus islandicus HVE10/4: SiH_0730Help
Entry
SiH_0730          CDS       T01952                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SiH_0730
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiH_0730
  Lipid metabolism
   00071 Fatty acid degradation
    SiH_0730
  Amino acid metabolism
   00350 Tyrosine metabolism
    SiH_0730
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SiH_0730
   00626 Naphthalene degradation
    SiH_0730
Enzymes [BR:sih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SiH_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
711191..712225
Genome map
AA seq 344 aa AA seqDB search
MKAMKIVEFGKPLELSEVGEITKTKSNQVLIRVQAAGVCHTDVSVRSGVIYKRISANPPR
LPLTPGHEIAGIVEEVGDEVTGFTKGDKVLINPWQGEGNCFYCKIGEDQYCDSPTWLGIT
TDGGFQEYVLSNHNYVYKIRNLSPYEAAPLACAGVTSYRASKLARLNPSSYVVIIGAGGG
LGSIGVQIIRALYGSIIIAIDVNDEGLELASKFGADYTLNSRKEVYQEVLKITNGRGVDA
IIDFVGSENTIKSYYTFLAKLGRYIKVGTFGGGLPNEAGLKIHSMGWQFIGTLTGNRKEF
LEVISLAENGRIKPVVTKLRLEEANEALDNLERNKVTGRQVLIP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgaaaattgttgagtttggaaaaccattagaactatcagaggttggcgag
attactaagactaaatcaaatcaagtattaataagagtccaagcagctggagtatgccac
acagacgtttcagtgagaagtggggtaatttacaagaggattagtgcaaatccaccaaga
cttccgcttacacccgggcatgaaatagctggaattgtagaggaagttggagatgaagtt
accggattcactaagggtgacaaagttctcataaatccctggcaaggtgagggaaattgc
ttctactgcaaaataggagaagaccagtactgcgactcgcctacgtggttgggtattacg
actgatgggggttttcaagaatacgtactatccaaccacaattatgtatataagataaga
aatctctcaccttatgaggcagcaccattagcttgtgctggggttacatcatatagggca
agtaaactagctaggttaaatccatccagctacgtagttataattggagccggaggaggg
ttaggaagtattggagtacaaataatcagagcactttatggttccataattatagctata
gacgtcaacgatgagggactagaactcgcctcaaagttcggagctgactacactttaaac
agtagaaaagaagtatatcaagaggtacttaaaataacgaatggaaggggtgtagatgcc
ataatagatttcgtaggctcagaaaacacgatcaaaagttactatacctttttagctaaa
ttaggaaggtacatcaaagtaggaacctttggcgggggtttacccaatgaggctggatta
aaaatacactcaatgggatggcaattcataggtacactaactggaaacagaaaggaattt
ttggaagtcataagccttgcggaaaacggtaggataaaaccagttgtcactaagttaagg
ttggaggaagcaaatgaggcattggacaacctggaaagaaataaggtaactggaagacaa
gtattaataccttaa

DBGET integrated database retrieval system