KEGG   Sulfolobus islandicus HVE10/4: SiH_0885Help
Entry
SiH_0885          CDS       T01952                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
sih00051  Fructose and mannose metabolism
sih01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SiH_0885
Enzymes [BR:sih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SiH_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADX82238
UniProt: F0NP52
Position
complement(897363..898085)
Genome map
AA seq 240 aa AA seqDB search
MVYMIGNTYCKLCQSSEQQLKEELVRTVKAFYYKGLVTNAGGNQSARLPGSKKVWMTPSG
YPRMSLSPEDLIAVDLDGNVIEGDLKPSIEVYAHLEVYKRRPDVNAVIHAHVPYVMGATI
SGYLETTHGEATAILGDVKIIPYYHPGTKELAKAVGEAFQGSGMKVPRVVITLNHGAFSA
GACIHEARAFMEILDEWARFNVAAKALGNIRHKLTLMDLRRLGAGYIRAVKFGGRPSKLS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtttacatgattggaaatacgtactgtaaattatgtcaaagtagtgaacaacaatta
aaggaagaattagtaagaactgttaaggcattttactacaagggattagttaccaatgct
ggtggtaatcaaagtgctagacttccggggagcaaaaaagtatggatgactccatctgga
taccctagaatgagcttatcaccagaggacttaatagcagtagatttagatgggaatgta
attgagggggatttgaagccatcaatagaagtttatgctcatctcgaggtttacaaaaga
agaccagatgtaaatgcagttatccacgctcatgtaccttacgttatgggagctacaatc
tctgggtatttagagacaacacatggtgaggctactgccatattgggtgatgtgaaaata
ataccctattatcatcctggtacaaaggagttagctaaggctgttggagaagcttttcaa
ggttccggaatgaaagtccctagagtcgtaataacgctaaaccatggtgctttttcagcc
ggggcttgtattcatgaggctagagcttttatggagattttagatgaatgggctaggttt
aatgtagccgctaaagcacttggaaatattagacataaactaacgctaatggatttaaga
agacttggagctggttatattagggcggtgaaatttggagggagaccaagtaagttgtct
tga

DBGET integrated database retrieval system