KEGG   Sulfolobus islandicus HVE10/4: SiH_0885Help
Entry
SiH_0885          CDS       T01952                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sih00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(897363..898085)
Genome map
AA seq 240 aa AA seqDB search
MVYMIGNTYCKLCQSSEQQLKEELVRTVKAFYYKGLVTNAGGNQSARLPGSKKVWMTPSG
YPRMSLSPEDLIAVDLDGNVIEGDLKPSIEVYAHLEVYKRRPDVNAVIHAHVPYVMGATI
SGYLETTHGEATAILGDVKIIPYYHPGTKELAKAVGEAFQGSGMKVPRVVITLNHGAFSA
GACIHEARAFMEILDEWARFNVAAKALGNIRHKLTLMDLRRLGAGYIRAVKFGGRPSKLS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtttacatgattggaaatacgtactgtaaattatgtcaaagtagtgaacaacaatta
aaggaagaattagtaagaactgttaaggcattttactacaagggattagttaccaatgct
ggtggtaatcaaagtgctagacttccggggagcaaaaaagtatggatgactccatctgga
taccctagaatgagcttatcaccagaggacttaatagcagtagatttagatgggaatgta
attgagggggatttgaagccatcaatagaagtttatgctcatctcgaggtttacaaaaga
agaccagatgtaaatgcagttatccacgctcatgtaccttacgttatgggagctacaatc
tctgggtatttagagacaacacatggtgaggctactgccatattgggtgatgtgaaaata
ataccctattatcatcctggtacaaaggagttagctaaggctgttggagaagcttttcaa
ggttccggaatgaaagtccctagagtcgtaataacgctaaaccatggtgctttttcagcc
ggggcttgtattcatgaggctagagcttttatggagattttagatgaatgggctaggttt
aatgtagccgctaaagcacttggaaatattagacataaactaacgctaatggatttaaga
agacttggagctggttatattagggcggtgaaatttggagggagaccaagtaagttgtct
tga

DBGET integrated database retrieval system