KEGG   Sulfolobus islandicus HVE10/4: SiH_1048Help
Entry
SiH_1048          CDS       T01952                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sih01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sih00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sih00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1062509..1063798)
Genome map
AA seq 429 aa AA seqDB search
MAMRIRIDLPQDEIPTQWYNILPDLPEELPPPQDPTGKSLELLKEVLPSKVLELEFAKER
YVKIPDEVLERYLQVGRPTPIIRAKRLEEYLGNNIKIYLKMESYTYTGSHKINSALAHVY
YAKLDNAKFVTTETGAGQWGSSVALASALFRMKAHIFMVRTSYYAKPYRKYMMQMYGAEV
HPSPSDLTEFGRQLLAKDPNHPGSLGIAISDAVEYAHENGGKYVVGSVVNSDIMFKTIAG
MEAKKQMELIGEDPDYIIGVVGGGSNYAALAYPFLGDELRSGKVRRKYIASGSSEVPKMT
KGVYKYDYPDTAKLLPMLKMYTIGSDFVPPPVYAGGLRYHGVAPTLSLLMSKGIVQARDY
SQEESFKWAKLFSELEGYIPAPETSHALPILAEIAEEAKKSGERKTVLVSFSGHGLLDLG
NYASVLFKE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagaataagaatagatttgcctcaagatgaaatacccacacaatggtataat
atcctaccagacttaccggaggaactacccccgccacaagatcccactggcaaatcccta
gaactattgaaggaagttttaccgagcaaggtgctggagttagagttcgctaaggaaaga
tacgtaaaaattccagatgaggttctggagagatatttacaagttggaagaccgactcca
ataattagggcaaaaaggttagaggagtacttaggaaataatatcaaaatctatctgaag
atggagagctacacttacactggttctcacaaaatcaacagtgccttagcacatgtatat
tacgctaaattggataacgcgaaattcgttacgacagaaactggagctggtcagtgggga
tcatcagttgcactagcctcagccctatttaggatgaaagcacacatatttatggttagg
actagctattatgcaaagccttacagaaaatatatgatgcagatgtatggagcggaagtt
catccttctccttcagatttaacagaattcggtagacaattattagctaaggaccctaat
catcctggatctttaggcatcgcaataagtgatgcagtagaatatgctcatgaaaacggt
ggaaaatatgttgtaggtagtgtggtaaattcagatataatgtttaaaacgattgccgga
atggaggctaagaagcaaatggaactgattggtgaagatccagattacattataggagta
gtaggagggggatcaaattacgcagcattagcttatccattcttaggagatgagctgagg
agtggaaaggttaggaggaagtatattgcctctggatcctcagaagttccaaaaatgact
aagggtgtttataaatacgattatccagacactgcgaaattgttgccaatgctaaaaatg
tacacaatagggtcggacttcgtaccacctccagtttatgcaggtgggctaagatatcat
ggagtagccccaactctcagtctattaatgagcaagggaattgtacaagcaagagattac
tctcaagaggagtcgttcaaatgggctaaattattctcagaactggagggatatatacca
gctccagagacttctcacgcattgccaatattggctgaaatagctgaagaggctaagaag
agcggagaaaggaagacagtactggttagcttctctgggcatggactactagatttgggc
aactacgcctcagtgttatttaaggagtag

DBGET integrated database retrieval system