KEGG   Sulfolobus islandicus HVE10/4: SiH_1276Help
Entry
SiH_1276          CDS       T01952                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
sih00260  Glycine, serine and threonine metabolism
sih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sih01100  Metabolic pathways
sih01110  Biosynthesis of secondary metabolites
sih01130  Biosynthesis of antibiotics
sih01230  Biosynthesis of amino acids
Module
sih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SiH_1276
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SiH_1276
Enzymes [BR:sih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SiH_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ADX82625
UniProt: F0NR42
Position
complement(1280230..1280961)
Genome map
AA seq 243 aa AA seqDB search
MGKLLVVYMTLGYPNVQSFKDFIIGAVENGADILELGIPPKYAKYDGPVIRKSYDKVKGL
DIWPLITDIRKDVSVPIIALTYLEDWIDQLDNFLNMMRDVKLDGVLFPDLLIDYIDDLDK
FDGIIKNKGLKNVIFTSPSVPDLLIHKVSKISDLFLYYGVRPTTGVPIPVSVKQLINRVR
NLVENKLIVGFGLSSESDLRDALSSGADGIAIGTAFIEEIEKNGVKSAINLVKKFRVILD
EYK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaactgcttgtcgtttatatgacgttaggttatcctaatgttcaaagtttcaag
gattttattattggggcagttgaaaatggagctgacatattagagcttggaattccccct
aaatatgccaagtacgatggtccagttataaggaagagttatgataaagttaaagggcta
gatatttggcctttaataacagatattaggaaagatgtcagtgttcctataattgcactt
acttacttagaggattggattgatcaactagataattttctaaatatgatgagagatgtc
aaactggatggagttctatttccagatttacttattgattatatagatgatttggataaa
tttgacggaataataaaaaataaaggattaaaaaatgttatttttacatctccttcagta
ccagatcttctaatccataaagtctctaagattagcgatttattcttatattatggtgtt
agaccaactactggcgtacctataccagtatcagttaagcagttgattaatagagttaga
aatctagttgagaataagctaatagtgggatttggcctatcaagtgagtcagatttaaga
gatgccttaagttctggtgccgacggaatagcaattggaactgctttcatagaagaaatt
gaaaagaatggcgtaaaatcagcaataaatttagttaaaaaatttagggtgatattagat
gaatataaatga

DBGET integrated database retrieval system