KEGG   Sulfolobus islandicus HVE10/4: SiH_1484Help
Entry
SiH_1484          CDS       T01952                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SiH_1484
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SiH_1484
Enzymes [BR:sih01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SiH_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1460125..1461036
Genome map
AA seq 303 aa AA seqDB search
MRLRHVVSSLDLTRDDYFRIFELADKFSNVKKLNYLSGKVVSLAFFEPSTRTAQSFHTAA
IKLGADVIGFASEESTSIAKGENLADTIRMLNNYSNCIVMRHKFDGAALFASEISDIPII
NAGDGKHEHPTQALIDLYTIYKVFGEIDGRTFGLLGDLKYARTVNSLLRALTRFKPKKIF
LISPSQLKVRREILDGLNYPVIETENPYDVIQDIDVLYVTRIQKERFVDELEYEKVKESY
VVDLKLVNMMKKDGIILHPLPRVTEIDRKVDKTTNAKYFYQASLAVPVRMALFYEVLGER
KDD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgagattaagacacgtagtttcttccctagacctgaccagagatgactattttcgaata
ttcgaacttgcagacaagttctctaatgtgaaaaaactaaattatctatcagggaaagta
gtttcattagctttctttgagccaagtactagaactgctcaaagctttcataccgcagca
ataaaattgggtgctgatgtaataggatttgcctcagaagaatctacttcgatagctaag
ggtgaaaatctagctgataccattaggatgttgaacaattactcaaattgtattgtaatg
agacataagtttgatggagcagcgttatttgctagtgagataagtgatatacctataatc
aatgccggagatggaaagcacgagcatcccacccaagcactcatagatttatatactatt
tataaggtgtttggcgaaatagatgggagaactttcggattattaggggatctgaaatac
gcaaggaccgtaaacagtttgctaagagcattaactagattcaaaccaaagaagatattt
ctaatttctccttctcagttaaaggtcagaagagagattttagatggattaaactatcca
gttatagaaactgaaaatccctatgacgtgatacaagatatcgacgtgttatatgtgact
cgaattcaaaaagaaagatttgttgatgaattagaatacgagaaagttaaggagagttat
gtggttgatctcaagttagttaatatgatgaagaaagatggaattatattgcatccatta
cctagggttaccgaaatagataggaaagtcgataaaactacaaacgctaaatacttctat
caagcatcattagccgttccagttagaatggctttattttatgaggttttgggtgaaagg
aaagatgattag

DBGET integrated database retrieval system