KEGG   Sulfolobus islandicus HVE10/4: SiH_1761Help
Entry
SiH_1761          CDS       T01952                                 

Definition
Superoxide dismutase
Orthology
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sih  Sulfolobus islandicus HVE10/4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1705827..1706462)
Genome map
AA seq 211 aa AA seqDB search
MTLQIQFKKYELPPLPYKVDALEPYISKDIIDVHYNGHHKGYVNGANSLLERLEKVVKGD
LQAGQYDIQGIVRGLTFNINGHKLHALYWENMAPNGKGGGKPGGALADLINKQYGSFDRF
KQVFTETANSLPGTGWAVLYYDTESSNLQIMTFENHFMNHIAEIPIILILDEFEHAYYLQ
YKNKRADYVNAWWNVVNWDAAEKKLQKYLTK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactctccaaattcagtttaaaaagtacgaattgcctccattaccctataaggtagat
gcattagaaccatatataagtaaagatataattgatgtacattataatgggcatcataaa
ggctatgtaaatggagcaaactcactcctagaaagactagaaaaagtagtaaaaggagat
ttgcaagctgggcagtacgatattcaaggcattgtgcgtggccttacgtttaacattaat
gggcacaaattgcatgccttatattgggaaaatatggcaccaaatgggaaaggtggtgga
aaacctggtggtgcactagcagacttaataaataaacaatatggtagttttgataggttt
aagcaagtatttactgaaactgctaattcactaccaggaactggttgggctgttctctat
tatgatactgagtcaagcaatttacaaattatgacgttcgaaaatcacttcatgaatcat
atagcagaaatacctataatattaatattagatgaattcgagcacgcgtactatcttcag
tacaagaacaagagagctgattacgttaatgcatggtggaatgtagtaaattgggacgca
gcggaaaagaagttacagaaatatttaacgaagtaa

DBGET integrated database retrieval system