KEGG   Sulfolobus islandicus HVE10/4: SiH_1899Help
Entry
SiH_1899          CDS       T01952                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SiH_1899
Enzymes [BR:sih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SiH_1899
Exosome [BR:sih04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SiH_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1828028..1829038)
Genome map
AA seq 336 aa AA seqDB search
MVTFPFLRPRRLRKNKLVRDLVAETTLFQDDLVLPIFIKESINEPEQITSMPGVYRYPPN
DKLVNYVQDSYENGIRSIILFGIPSYKDEIASSAYDKNGVIQRAVKIIKDSFKDKIIVIT
DECTDEYTSHGHCGLVNYNNGCYVIDNDESLKIHAKIALSQAEAGADIIAPSSMMDGVVK
AIRDALDGAGYNDILIMSYSVKYASIMYGPFRDAAYSKPAFGDRRGYQMDPRNAFEALKE
ARLDIEEGADILMVKPAHTYLDVIRLVKDHFPEYPLAAYHVSGEYSMIKAAAINGWIDER
TAVLEITTAIKRAGADLIITYYANDIVRWIKEGVPF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggtaacattcccatttttgagaccaagaagattaagaaaaaacaaattagtaagagat
ctagtagctgaaacgactctttttcaagacgatttagtacttccaatatttataaaggaa
agtataaatgagccagaacaaattacttcaatgccaggagtgtacagatatccaccaaat
gataagttagtcaattatgtacaagatagctatgaaaatggtattcgaagtattatattg
tttggaattccatcttataaagacgagatagcatcatcagcctacgataaaaatggtgta
atacagagggcagttaaaataataaaagatagttttaaggataagattatagtaatcaca
gacgagtgtactgatgagtatacgtctcatggtcattgcggtcttgtgaactataataac
ggatgttatgtaatagataatgatgaaagcctaaagattcatgcaaagattgcattaagc
caagctgaagctggagcagatattatagccccatcaagcatgatggacggtgttgttaag
gctataagagatgcgctagatggagctggttacaatgatatattgataatgtcatacagt
gtaaagtacgcttcaataatgtatggtccttttagggatgcagcttactctaaaccagcg
tttggagataggagagggtatcagatggatcctaggaacgcatttgaagcactaaaagaa
gctagattagatatagaggaaggagctgatattttgatggttaaacctgcccatacatat
ttagatgtaataagattagtaaaagatcacttcccagaatatcccctagcggcatatcat
gtcagtggtgaatatagcatgataaaagcagcagcaattaatggatggatagatgaaagg
actgccgtattggaaattactaccgcaataaaaagagcaggggctgatttaattattact
tattatgctaacgatattgtaagatggataaaggaaggtgtaccattttga

DBGET integrated database retrieval system