KEGG   Sulfolobus islandicus HVE10/4: SiH_2506Help
Entry
SiH_2506          CDS       T01952                                 

Definition
thiamine pyrophosphate domain-containing TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SiH_2506
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiH_2506
   00020 Citrate cycle (TCA cycle)
    SiH_2506
   00620 Pyruvate metabolism
    SiH_2506
   00640 Propanoate metabolism
    SiH_2506
   00650 Butanoate metabolism
    SiH_2506
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiH_2506
   00680 Methane metabolism
    SiH_2506
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SiH_2506
Enzymes [BR:sih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SiH_2506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2414121..2415020
Genome map
AA seq 299 aa AA seqDB search
MSLGLREILNKHNGILSGTSACPGCPENMAMRMLGMGLGKDMVLVVVAGCSSVIQGNAPY
NAYNFPTVNVAFAAGPATAAGLARAYKQRGKNVTVVVWAGDGGSADIGFASLSGAAERND
NILYLTVDNEAYMNSGGQRSGSTPFGAITTTTPEGKKENKKNLPLLMIAHNVPYVATASV
GYPHDYIEKLKKAKQVEGFKYIHVLTPDPYGWLFDPSKTAEVAKLAVQTCYWPLFEYYNG
KLSINSESLHCLDRRTRRPIRDFLGVQGRFKRLTEDQIKILEQYIDNVWEKLKSMLDNQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttaggactccgagagatattgaataagcataatggtatcttatccgggacttca
gcttgtcccggctgcccagagaatatggcaatgagaatgctaggaatgggactaggtaaa
gatatggttctagtagtagttgcgggatgttcctcagtaatacaaggaaatgcgccttat
aatgcttacaacttccctactgtgaacgttgcctttgcggctggtccagctacggctgct
ggtttggctagagcgtataaacaaagaggtaagaatgtcactgtagtggtttgggctgga
gatggaggaagtgctgatataggatttgcatcattaagcggagctgctgagagaaatgat
aatatactctaccttactgtggataacgaggcctatatgaatagtggagggcagagaagt
ggctcaactccctttggagcaattactactactactccagagggaaaaaaggaaaataag
aaaaacttgccattattaatgatagcgcataacgtaccttatgtggctactgcatctgta
ggatatccacatgattatatagagaagttaaagaaagccaagcaagtcgaaggtttcaaa
tatattcacgtcctaactcctgatccttacggttggttatttgatccttcaaaaactgct
gaagtggcaaaattggcagtacagacttgctattggcccctctttgaatactataatgga
aaattaagcattaattcagaaagtttacattgtcttgacagaagaactagaagacctata
agagactttctaggtgttcaaggaagattcaagagattgacagaggatcaaataaagatt
ttagagcaatatatagataacgtgtgggagaagttaaaatccatgctcgataatcagtaa

DBGET integrated database retrieval system